SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078233 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078233
Domain Number 1 Region: 25-126
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000445
Family Insect pheromone/odorant-binding proteins 0.0039
Further Details:      
 
Domain Number 2 Region: 139-238
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000127
Family Insect pheromone/odorant-binding proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078233   Gene: FBgn0046878   Transcript: FBtr0078584
Sequence length 242
Comment type=protein; loc=3R:join(1933909..1933959,1934023..1934352,1934991..1935338); ID=FBpp0078233; name=Obp83cd-PA; parent=FBgn0046878,FBtr0078584; dbxref=FlyBase:FBpp0078233,FlyBase_Annotation_IDs:CG15582-PA,GB_protein:AAF51919.2,REFSEQ:NP_649612,GB_protein:AAF51919,FlyMine:FBpp0078233,modMine:FBpp0078233; MD5=1bf69e01a6ec17f8e87f76d68f8ad83a; length=242; release=r5.30; species=Dmel;
Sequence
MQMKSGILIALCLCLSLNEGLALLEHEGETINRCIQNYGGLTAENAERLERFKEWSDSYE
EIPCFTRCYLSEMFDFYNNLTGFNKDGIVGVFGRPVYEACRKKLELPFESGESSCKHAYE
GFHCITNMESHPFTVIDNMPNISPSAKDAMKDCLQDVHQDEWKSFDAFAYYPVNEPIPCF
TRCFVDKLHIFEEKTRLWKLEAMKQNLGIPAKGARIRTCHRHRGRDRCATYYKQFTCYAM
AV
Download sequence
Identical sequences Q9VNL1
NP_649612.1.81976 7227.FBpp0078233 FBpp0078233 FBpp0078233 FBpp0078233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]