SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078481 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078481
Domain Number 1 Region: 257-400
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-40
Family Third domain of FERM 0.00033
Further Details:      
 
Domain Number 2 Region: 153-259
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-31
Family Second domain of FERM 0.0000698
Further Details:      
 
Domain Number 3 Region: 67-153
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.01e-21
Family First domain of FERM 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078481   Gene: FBgn0051536   Transcript: FBtr0078840
Sequence length 404
Comment type=protein; loc=3R:join(743596..743853,748314..748546,748669..748890,748956..749199,749254..749414,749476..749572); ID=FBpp0078481; name=Cdep-PC; parent=FBgn0051536,FBtr0078840; dbxref=FlyBase:FBpp0078481,FlyBase_Annotation_IDs:CG31536-PC,GB_protein:AAF52081.2,REFSEQ:NP_649505,GB_protein:AAF52081,FlyMine:FBpp0078481,modMine:FBpp0078481; MD5=a6ad4fca7e621cdeb19b599d4265e762; length=404; release=r5.30; species=Dmel;
Sequence
MSLADMGTASRSAGGEGGRHYDLATGGAGSGGHPVGGGLPGGRMTHSLSTPSGVDGTPST
PRHRGGKKLTVRIQMLDDSITMFQVQAKALGRVLFEQVCRQLNLLEADYFGLEYQEVSTH
TKYWLDLEKPMNRQVGLSLIDPVLRFCIKFYTPDPAQLEEEYTRYLFCLQIKRDLATGSL
QCNDNTAALMASYIVQASCGDFVPEDYPDHTYLSSYRFVPNQDATMQRKIMENHKKHVGQ
SPAEADLNLLETARRCELYGMKMHPAKDVEGVPLNLAVAHMGITVFQNITRINTFSWAKI
RKISFKRKRFLVKLHPEGYGYYKDTVEFFFEGRNECKNFWKKCVENHGFFRCTAVQNTPR
RKTRVLSRGSSFRYSGKTQKQIIEFVRENYVKRQNFQRYKTNSS
Download sequence
Identical sequences Q9VN68
FBpp0078481 FBpp0078481 NP_649505.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]