SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078941 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078941
Domain Number 1 Region: 824-1038
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-105
Family Thrombospondin C-terminal domain 0.000000181
Further Details:      
 
Domain Number 2 Region: 701-821
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.7e-31
Family TSP type-3 repeat 0.0000162
Further Details:      
 
Domain Number 3 Region: 630-707
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.22e-17
Family TSP type-3 repeat 0.00035
Further Details:      
 
Domain Number 4 Region: 561-644
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000248
Family TSP type-3 repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 470-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000233
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 385-519
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000133
Family Growth factor receptor domain 0.011
Further Details:      
 
Weak hits

Sequence:  FBpp0078941
Domain Number - Region: 530-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000345
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 343-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0942
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078941   Gene: FBgn0031850   Transcript: FBtr0079312
Sequence length 1060
Comment type=protein; loc=2L:complement(6686925..6686995,6687064..6687197,6687254..6688737,6688796..6689118,6690977..6691098,6697010..6697127,6697263..6697457,6699765..6699902,6699987..6700116,6700181..6700496,6700553..6700619,6701750..6701834); ID=FBpp0078941; name=Tsp-PA; parent=FBgn0031850,FBtr0079312; dbxref=FlyBase:FBpp0078941,FlyBase_Annotation_IDs:CG11326-PA,GB_protein:AAF52425.2,REFSEQ:NP_523495,GB_protein:AAF52425,FlyMine:FBpp0078941,modMine:FBpp0078941; MD5=bd9273bdc61bbbaceece020d97293053; length=1060; release=r5.30; species=Dmel;
Sequence
MNWTRVLLIGLTALALTFVDVASLSLDPVASAELEQFIRKGDVVISTRHIRPRRKLHISI
EALFMIDFPMLKHKMSFFLDRKQQRVTLDISANGATESRNFEIPNINETSTIRSLALQFS
KNRITLHVDCKASTHHDIDMNLAKLYTQMDDPVIKLFRERKYPLHFDGDMEHSLQRANCQ
KGNHRRGNRRMLRNKITEREKNKKRDVRGWYEPTIAREGVVDHRHQEVPTDVERGDIPVL
NGDCEDALARSLSDLLALVKLLREDVAHQRQEIAYLRMLLENCAGCKNPLTTDNQLRIEP
DCRSANPCYPGVECLDSAAGPRCGHCPLGFIGDGKSCKPGVTCAHHMCYPGVQCHDTVNG
AQCDSCPAGYEGDGRTCSLRNPCLDTPCPSGAQCLQVGYPPYFHCISCPMGHEVNGTSCR
DMNECLLYDPCDELATCTNLSPGFQCSPCPVGFDGTHAHGYFADYYSVDYRRQTCLDVDE
CRTGFFRCPEHSTCINEIGSYRCQCHEGYVTNGTYSCLDRSSVFMCPDGTVCDRNAVCLR
MDNIRHKCHCNVGWAGNGLICGRDTDVDGWPDQAIGCPELRCQRDNCPKLPNSGQEDADL
DGHGDGCDDDADGDNVQNSQDNCWLAYNTEQLDSDGDKVGDVCDNCVLKYNPRQLDTDED
GLGDECDGDIDNDSIPNALDNCPLLPNPSQSDVDNDGVGDACDNCPNLPNPDQKDRDMDF
VGDACHRDIDGDDDGVPNSLDNCPMVSNSDQLDTDGDGTGDECDDDMDGDGIPNYKDNCP
LAKNPKQDDFNRNGKGDSCEDDEDVDGVPNGMDNCPNNSMIHHTDFRTLQTIPLDPKGLS
QADPNWVVHANGTEIVQTLNSDPGLAVGKDAFGGVDFDGTFYINDDTDDDYAGFVFSYQS
SYKYYVVQWKKGTQTYWEPRPFTASAAPGIQIKLVNSTEGPGPMMRNSLWHEGNTDGEAR
LLWKDPKNIAWKERTSYRWSLVHRPAIGLIRLQMHEGNRLIFDSGNVFDSTLKGGRLGVF
CFSQRMIIWSNLQYKCNNRVKPLIYNDLSDYLKTKVELQD
Download sequence
Identical sequences Q9VM97
FBpp0078941 FBpp0112980 FBpp0078941 FBpp0112980 NP_001137802.1.81976 NP_523495.2.81976 7227.FBpp0078941 FBpp0078942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]