SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079113 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079113
Domain Number 1 Region: 837-885
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000949
Family Laminin-type module 0.0047
Further Details:      
 
Domain Number 2 Region: 1043-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000725
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 3 Region: 991-1038
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000753
Family Laminin-type module 0.0014
Further Details:      
 
Domain Number 4 Region: 1094-1144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000103
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 5 Region: 883-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number 6 Region: 355-420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 7 Region: 789-830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000232
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number 8 Region: 529-567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000781
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 9 Region: 288-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000018
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 10 Region: 442-480
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000187
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 11 Region: 945-993
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000193
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 12 Region: 1142-1189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 13 Region: 478-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000159
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 14 Region: 1571-1659
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.0000188
Family Apolipophorin-III 0.0011
Further Details:      
 
Weak hits

Sequence:  FBpp0079113
Domain Number - Region: 125-184
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00034
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.085
Further Details:      
 
Domain Number - Region: 1339-1477
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000549
Family HBL-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079113   Gene: FBgn0261800   Transcript: FBtr0079490
Sequence length 1788
Comment type=protein; loc=2L:join(7814948..7817656,7817733..7820390); ID=FBpp0079113; name=LanB1-PA; parent=FBgn0261800,FBtr0079490; dbxref=FlyBase:FBpp0079113,FlyBase_Annotation_IDs:CG7123-PA,GB_protein:AAF52563.1,REFSEQ:NP_476618,GB_protein:AAF52563,FlyMine:FBpp0079113,modMine:FBpp0079113; MD5=a6326cdf8fd806bb9123b0c40164dfe7; length=1788; release=r5.30; species=Dmel;
Sequence
MLELRLIVVIVLALLSWQWDPVDSQRPPQHGRRDRPKYPPNKFIKTHPCERSSCYPATGN
LLIGRENRLTASSTCGLHSPERFCILSHLQDKKCFLCDTREETKHDPYKNHRIGQIIYKT
KPGTNIPTWWQSENGKENATIQLDLEAEFHFTHLIITFTTFRPAAMYIERSFDFGQTWHI
YRYFAYDCKESFPGVPTVLENITDVMCTSRYSNVEPSRNGEVIFRVLPPNINVTDPYAEH
VQNQLKMTNLRIQMTKLHKLGDNLLDSRLENEEKYYYGISNMVVRGSCSCYGHASQCLPL
DPAFSQADNEDGMVHGRCECTHNTKGMNCEECEDFFNDLPWKPAFGKKTNACKKCECNDH
AVSCHFDEAVFTASGFVSGGVCDNCLHNTRGQHCEECMPYFYRDPEQDITSERVCQPCDC
DPQGSSDDGICDSLNELEEGAVAGACHCKAFVTGRRCNQCKDGYWNLQSDNPEGCEPCTC
NPLGTLNNSGCVMRTGECKCKKYVTGKDCNQCMPETYGLSESPEGCSLCNCDAGGSYDNY
CDVISGQCRCRPHMTGRSCSQPKQNYFIPLLPEVHEAEVVDECISYGANGNCSLVAETPD
GSFTGIGFTRVPENSELVFTVGDIPRSMPYDAVIRYQSTSRGDWENAFITLVRPDQVDPE
GGCGELAAATSSETRIPFSLPDRSRQVVALNEVCLEAGKVYKFRIYFERKRHDVDSPTAT
ILVDSLTLIPRIDVTPIFQGSVLADIRKKDYEKYNCKSSLYDMNYKSDPKCQNLDNILSV
FVHDGASMCNCNPTGSLSKVCESNGGYCQCKPNVVGRQCDQCAPGTYGFGPEGCKACDCN
SIGSKDKYCDLITGQCQCVPNTYGRECNQCQPGYWNFPECRVCQCNGHAATCDPIQGTCI
DCQDSTTGYSCDSCLDGYYGNPLFGSEIGCRPCRCPETVASGLAHADGCSLDTRNNNMLC
HCQEGYSGSRCEICADNFFGNPDNGGTCSKCECSNNVDLYDTGNCDRQTGACLKCLYQTT
GDHCELCKDGFFGDALQQNCQQCECDFLGTNNTIAHCDRFTGQCPCLPNVQGVRCDQCAE
NHWKIASGEGCESCNCDPIGALHEQCNSYTGQCQCKPGFGGRACNQCQAHYWGNPNEKCQ
PCECDQFGAADFQCDRETGNCVCHEGIGGYKCNECARGYIGQFPHCSPCGECFNNWDLIL
SALEDATTATILRAKEIKQVGATGAYTSEFSELDKKLQHIRNLLQNTSVSLVDIEKLDYE
TQSLRDQLQASHGRLSETEQNLDDIYNSLSLSGVELESLQNHSRLVQQLSKELKENGIQL
QESNIEGALNLTRHAYERVSNLSTLKDEANELASNTDRNCKRVENLSNKIQAEADDLANN
NKLIEDYRAELTSLTSQIPELNNQVCGKPGDPCDSLCGGAGCGHCGGFLSCEHGAKTHSE
EALKVAKDAETAITSKKDQADQTIRALTQAKLNASEAYEKAKRGFEQSERYLNQTNANIK
LAENLFIALNNFQENKTASPSESKELAQKTLDLDLKLEPEEIETLGDQINRAVSSLKNVE
AIIYRTKPDLDRVNNLQSIANATKEKADKILDSANSVVESLAAADESQGKAKDAIQQANS
NIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEITKEAGS
VKLEAMRARGEANNLQSATSATNQTLTDRASRSENARERAKQLLQRASKLTVDTNAKLKD
LNDLQTVYLNKNQQLLRLQAEIGPLNKELNEHLIHIKERGSHYRQCYT
Download sequence
Identical sequences P11046
7227.FBpp0079114 FBpp0079113 FBpp0079114 NP_476618.1.81976 NP_723319.1.81976 FBpp0079113 FBpp0079114 FBpp0079113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]