SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079163 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079163
Domain Number 1 Region: 1589-1864
Classification Level Classification E-value
Superfamily Kelch motif 4.58e-41
Family Kelch motif 0.012
Further Details:      
 
Domain Number 2 Region: 370-636
Classification Level Classification E-value
Superfamily Kelch motif 6.67e-31
Family Kelch motif 0.013
Further Details:      
 
Domain Number 3 Region: 28-150
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-18
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 4 Region: 1311-1359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 5 Region: 1378-1493
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000419
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 
Domain Number 6 Region: 219-274
Classification Level Classification E-value
Superfamily Kelch motif 0.000000981
Family Kelch motif 0.036
Further Details:      
 
Domain Number 7 Region: 1188-1223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000131
Family EGF-type module 0.009
Further Details:      
 
Domain Number 8 Region: 2305-2354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000188
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 9 Region: 2358-2431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000314
Family Laminin-type module 0.046
Further Details:      
 
Weak hits

Sequence:  FBpp0079163
Domain Number - Region: 1264-1311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000167
Family Laminin-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079163   Gene: FBgn0031981   Transcript: FBtr0079541
Sequence length 2898
Comment type=protein; loc=2L:join(8043715..8044071,8044344..8044778,8044847..8046769,8046824..8049217,8049280..8051698,8051880..8053048); ID=FBpp0079163; name=CG7466-PA; parent=FBgn0031981,FBtr0079541; dbxref=FlyBase:FBpp0079163,FlyBase_Annotation_IDs:CG7466-PA,GB_protein:AAF52597.3,REFSEQ:NP_609180,GB_protein:AAF52597,FlyMine:FBpp0079163,modMine:FBpp0079163; MD5=3dbed6b8fdfd98087bc67fbcf6846363; length=2898; release=r5.30; species=Dmel;
Sequence
MYALLATLTFWTLVLQTEQAHPSTSPSAPCDRSRKVFTEPYGEISDGPSGFNYTQDSHCE
WLIKARNDSQYITLTFHSMGTECSYDYIYVYDGDSFNSTLLGSFSGRTQPQRLVARSGSL
IFFLQMLILMYSDTNYVLDGFRASYYISNCLNNCHNHGKCVGHQCVCHGEWVGPDCEDEA
CPQRCGESQGRGRCQKSICHCSRGYSGRLCDLSDHPAGSSWRWLATDAEGMTARAAHSAV
YMEDEDALYVFGGYDLNNVISTLQIYRFSTSQWEDEWGIALQSRRHFYHPQKIDHTLLKA
VLQHKNEDEAKLWGLNSDVSFFRNILYTLAESNLHQRRTRSSLPLTIVNANSTDEELNEY
LEDILEEVTDHKPHGRYGHAADSVPGGFVIYGGKHANGSFYSDLWQYNNTESGGKWKQMA
IRSAVKPPALARHTLNTAGSYLYIFGGSLETGEFSSSVYRIPLPLSEDSQWELVQPRGGK
TLDVRLAAHSTVYYKATNSLIVFGGIMTSLARFSKLSDRIYAFQLDQMHWTEILYPRTAL
RDTNIPRERAFHTATISGNYMVVFGGYTHRHNKDEICYDNQMYWYHLSCHIWINQVVSAD
DSLYPKPQGVFAHAAALRRNHTLLIVGGYHGNVNADLFAYELPQVLRVENTLYNPEISCR
LHSSHTACLSNPECGWCSADSSCYGRTIGANCTTNLQTTRCPGICPSLGDCHSCLVHGSQ
WGKSSGNKAAFSVASKLGLNECTWCVQNAKCHHRDDNYGICGDSSGWWGDKGTEIRRPSL
CTSTDRRPGLTYIKYHFPINYTMPDYVGIVNATMVDFASPPFTTYFEHKLEGEMLARLVG
FVRPQHQWNNSAIQVCTSYSSAVLRAGLGLNLDELVNVTTQSSNQSYCSNVQLPTTEQPF
TIDFQTRRRIGGNGIYNAYQKTKMELQHLHNGQLNAFTFEYLEPYYSGKCTQYSNCLHCL
TDASCAWCPLTNICHLRSVNETEVCKMETLDTFHWSYLISQPSQCSNCTNYVSCEACARS
GECEWWTEDARCGRIGKTNSSVRAVEHCPRSCRERHGCQECLGERGRCVWCEASAQCFSF
SVYTSEYQFGMCREWVDQVVSRQTQEIADHKPQQTPHFLQQQCKSCEQHRNCSSCLRTLS
CGWCFDRDNPIEGICMQGDFSYSAGNCSLALNSSSHHDAEWAYAQCPDVDECGLGLHDCH
KEAKCTNTQGSYNCHCRRGYIGDGKFSCVRTCYELCQNGNCSGPPDYTCRCALGWTGADC
GLSCGCNNHSTCNERLGKCDQCQDWSEGEKCERCRQGSYGNATAPHGCLPCECNGHGNQD
LGVCNVSNGECYCKDNTQGLNCELCAPGYYGDPRGGGKCYYQCESRGILTNIGKSAIGSY
QSYRSPWGASLEVKECLWILQPKTLQAEKSLLQLEFQWQSLAMDCDENAVYIYDSLPDLT
GATQQNQLLAVVCAPYSSPRIIEARSSHVTVHYKQGSERRHFGFNALYSVMNCVAGSCIS
PHICDAQQRCVCPAGYVGASCEIEICPSNCNAKRMQGFCDTEYGRCICSNANYAGADCGT
LVQRNHLVMTELFNTQLLSESLEHLRKTIPRFGHSVNADRRGSLWMFGGYSPNHGPLNDF
RQFDTKNSTWLQVTVESSTPEDRMPLGRYFHASEIYVKKQIIYIYGGIGANSQLLNDFWM
FSIQNQRWSQIKVEVEPPEADYEVDVPPPLAGHTLTHIRYQEHESLILLGGLSLNKSRPL
ELWEFNLDTGRWQQLAAVGARMPVLYGHTSVYHQETNSVYLFGGYSTEPQSNLYALDLQK
LSWTELPSFRELNSPASLLPRARYFHSAVTTEHYMILYGGRTQPFNGTDVLIAYVYACNQ
WVRLTEDVELIGRVPASSYAEDMAIDPDTGAIYVIGGWDGSSTHSHVTKITLPDDICQLW
SNGKYQCRHYMGCSYCTIQNTYSYSSHCFSHGRTPCANHNGTLVVNNGAACDDDWMASRN
CSSFATCGACLAAWPTHQEVAPVCHWCDDCGIRGRCVPAGVDCGRRSAWCNKELSVGVLG
LCPLPQCYQLSCESCMLQPQCNWARNELGTVECIAKELVEKNQYRVVESCPLPCHTYENC
SLCLSQTPTQDHQECKWSTMLNLCLTPSSQPLLCAGGVCGLVLEASELQRCPEPCHVYTQ
CSSCLEHAHCGWCAREGFNGDGICTEGALEHKQEHPSGSTCDLIYASWRNDSQLTHADVV
SWHYVQCPAENECINGHHNCDTVSEQCIDLDTAVGYKCVCAQGYREEQGACLPVCSQGCV
RGNCVSPDQCQCDFGYVGANCSIQCLCNGHSNCESSSRLDICLKCHNNTMGEQCEKCQPL
FVGNPREGHACQPCLDYCHGHSDVCVAYDADPAVFNMTRSELERILQEGPAYNATCLRCG
NHTAGDRCDSCLTGYFRGSEDLHKECRPCQCHGHGNICDPVTGEKCNCANNTESDATCTA
GGGKNSAQLCWMVQCSKCRDSYAGNPTDGHQCYKQITVESRMCFDAKPIEECKSKPAALK
PGQTVFFVIQPRFMNVDIRIIIDVTQGELDVFMSPQDDSFIVETNETTGYHEIFLDNRYN
WGPKIKREHPLNVALPRHDNVTIQKLFSPERRIGGGGLGGGGGERIGANTYYVPQLQDCK
SHGGHNFIVKDQHAKDLSTHVTLNHCNTLLRLFGLKNRLVLTLPQHAHNLSATRFFIALR
ASSGPEPSYGSVVFRQDQLHIDLFVFFSVFFSCFFLFLAVCVIVWKVKQAADLRRARRQH
VVEMLHLAKRPFAQIFLASNGLDMDSPQPTSSSSSARAMRQRARQALLLQEQSAGDSQSV
MHHSTRRQSSRIMMVAIEPTFDNLAAVGTVFISLPGRSRAPLSIALGSTLISYSRQYPLN
TRHFMRAQRGQNVANHPA
Download sequence
Identical sequences FBpp0079163 7227.FBpp0079163 FBpp0079163 FBpp0079163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]