SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079235 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079235
Domain Number 1 Region: 324-594
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-77
Family Protein kinases, catalytic subunit 0.0000000514
Further Details:      
 
Domain Number 2 Region: 195-317
Classification Level Classification E-value
Superfamily SH2 domain 3.04e-31
Family SH2 domain 0.0000977
Further Details:      
 
Domain Number 3 Region: 140-216
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000249
Family SH3-domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079235   Gene: FBgn0003502   Transcript: FBtr0079615
Sequence length 603
Comment type=protein; loc=2L:complement(8260538..8260636,8260698..8260831,8260909..8261681,8261740..8261868,8261943..8262073,8262139..8262219,8262285..8262401,8262475..8262680,8271936..8272077); ID=FBpp0079235; name=Btk29A-PC; parent=FBgn0003502,FBtr0079615; dbxref=FlyBase:FBpp0079235,FlyBase_Annotation_IDs:CG8049-PC,GB_protein:AAN11162.1,REFSEQ:NP_723370,GB_protein:AAN11162; MD5=60c36c6361277df0cb21fb8474ad0133; length=603; release=r5.30; species=Dmel;
Sequence
MIPCVSLAETSVIGNMKERVKEMKVFGCRLNFWNHIGHSLTSSKTKEGNGSSPAQNSTRS
ISPNSSTTNSQFSLQHNSSGSLGGGVGGGLGGGGSLGLGGGGGGGGSCTPTSLQPQSSLT
TFKQSPTLLNGNGTLLDANMPGGIPTPGTPNSKAKDNSHFVKLVVALYPFKAIEGGDLSL
EKNAEYEVIDDSQEHWWKVKDALGNVGYIPSNYVKPKALLGLERYEWYVGDMSRQRAESL
LKQGDKEGCFVVRKSSTKGLYTLSLHTKVPQSHVKHYHIKQNARCEYYLSEKHCCETIPD
LINYHRHNSGGLACRLKSSPCDRPVPPTAGLSHDKWEIHPMELMLMEELGSGQFGVVRRG
KWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTEYMKH
GSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENVVKV
ADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKMP
YGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQLALVAQT
LTD
Download sequence
Identical sequences A0A0J9TIR1 A0A0R1DS41
FBpp0079235 FBpp0079238 FBpp0111748 FBpp0079235 FBpp0079238 FBpp0111748 NP_001097120.1.81976 NP_476746.1.81976 NP_723370.1.81976 XP_015053020.1.41174 XP_015053021.1.41174 XP_016024150.1.80810 XP_016024154.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]