SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079369 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079369
Domain Number 1 Region: 967-1113
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.09e-35
Family Toll/Interleukin receptor TIR domain 0.00054
Further Details:      
 
Domain Number 2 Region: 243-347,421-501,629-730,793-901
Classification Level Classification E-value
Superfamily L domain-like 8.69e-23
Family Ngr ectodomain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079369   Gene: FBgn0032095   Transcript: FBtr0079768
Sequence length 1125
Comment type=protein; loc=2L:join(9084107..9084230,9085420..9085527,9086242..9086923,9086977..9089440); ID=FBpp0079369; name=Toll-4-PA; parent=FBgn0032095,FBtr0079768; dbxref=FlyBase:FBpp0079369,FlyBase_Annotation_IDs:CG18241-PA,GB_protein:AAF52747.3,REFSEQ:NP_523519,GB_protein:AAF52747,FlyMine:FBpp0079369,modMine:FBpp0079369; MD5=435b33c317e5c7d16daf69230c45ed29; length=1125; release=r5.30; species=Dmel;
Sequence
MEHSKLWDLRPEVRERRFKWTSDGQQQQQQQLGWCNNKDDPPNSHQKSKSNNDARNLNSR
VRVRARVRVVPGEMRMGDINCSNGLGNIREDYCEIYLDELGENGTCSIANNEVTTEDYQM
KLVFLKLEINWTSPVFHGWNIFKICNETDYELVIISVLGIRSEVDMRISPAVQYLSLLGI
REISGYDIYLPSVLITEMDVHHANGPKMVTFKYLYDSTVNSVITNNYIRKTMNNTEKIKI
YYHNTFEKTTLTMEKNIFHGKNKMSALIFNGLKIKGLTNNTFENLTSLNTLIFDNVFLKD
LSFLRSSTLQSSLTYCIMKVDNMVDLKSFEKFTNLEIIEVSQYKGFKNFTAFICEPYKSH
CKFTLGINEVACPLKCNCSYNRDKSQLEIDCWQKNLTTIPSLPVPKKGSSALVFQSNLLA
ELPDNSLEGYHNLKSLDVSYNQLTSLSVSQLPESLHYLDIRHNKITTLSPQVVEYLYSVN
VFNQYGNKWSIYCDEYHLQEFFWYKAKLLRIKTSKFQTIMEYIELSSKGSFVENFFVQNI
DQLYLEANEDEIIDAFGPSDKYFNLKLMEALNHAIWLFSGEFDEIILHHLNSPCPYRCSC
CFEWHTGEFLINCRNLSLDIYPRLPNSIPYKTTLYLDRNEIRKLTNTESLVVAGHASIHK
LHMSQNLLRELPLHLLPENITYLDVRNNLLKYLDDGVIAFLEYRENITKIELSGNPWECN
CKAKAFLSFLRRHEPMEYETVLRRVEITDDKCPEDCICCVDTSNSDSLAYVVDCSGKELS
EIPQLPTPTYGQTTLVFERNSLKKWPSSLLPGYSSVTRFYLAHNRLSDIDQLPDKLEYLD
ISNNNFSALDDRVRGFLQKRMNSSQLQLSLFGNPWTCRCEDKDFLVFVKEQAKNIANASA
IQCIDTGRSLIEVEETDICPSVLIYYTSLAVSLLIIALSINVFICFRQPIMIWFYEHEIC
LSLAARRELDEDKKYDAFLSFTHKDEDLIEEFVDRLENGRHKFRLCFYLRDWLVGESIPD
CINQSVKGSRRIIILMTKNFLKSTWGRLEFRLALHATSRDRCKRLIVVLYPDVEHFDDLD
SELRAYMVLNTYLDRNNPNFWNKLMYSMPHASHLKRSRSDAETKV
Download sequence
Identical sequences Q9VLE6
FBpp0079369 FBpp0079369 FBpp0079369 NP_523519.2.81976 7227.FBpp0079369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]