SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079600 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079600
Domain Number 1 Region: 102-186
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.4e-17
Family Canonical RBD 0.0000462
Further Details:      
 
Domain Number 2 Region: 6-68
Classification Level Classification E-value
Superfamily RING/U-box 1.1e-16
Family RING finger domain, C3HC4 0.0000688
Further Details:      
 
Weak hits

Sequence:  FBpp0079600
Domain Number - Region: 188-217
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00169
Family CCCH zinc finger 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079600   Gene: FBgn0051716   Transcript: FBtr0080010
Sequence length 1051
Comment type=protein; loc=2L:join(10398115..10398219,10398279..10398392,10398444..10398593,10398654..10398740,10399317..10399535,10399595..10399688,10399768..10400679,10400735..10400869,10400963..10400998,10401077..10401271,10401334..10401594,10401662..10401741,10401804..10401867,10401926..10402333,10402407..10402562,10402631..10402770); ID=FBpp0079600; name=CG31716-PC; parent=FBgn0051716,FBtr0080010; dbxref=FlyBase:FBpp0079600,FlyBase_Annotation_IDs:CG31716-PC,GB_protein:AAN10747.1,REFSEQ:NP_723580,GB_protein:AAN10747; MD5=ba146f38c080427df7412f2ccac82bf1; length=1051; release=r5.30; species=Dmel;
Sequence
MNGLSSNDDAVECPLCMEPLEVDDLTFFPCTCGYQICRFCWHRIRTDENKLCPACRKEYP
ENPADFKPLSQEEMIAFKSQKRQRDQQRKQKITENRKHLANVRVVQKNLVFVVGLPPRLA
DADILKKHEYFGKYGKIHKVVINPSTTYAGVQGPSASAYVTYVNNSDALRAIQSVNNIMI
DGRLIKTSLGTTKYCSHFMKNQQCPKGDCMYLHELGDPEASFTKEEMHQGKHLEYEKRLH
DTLIASLGPNATGIVNVAIPSSSSASSSSSGSGTNGSSASGNAQQKEAWPSLSVSPINGK
EAAATATSSSGKSKREKLRNEKRHEKNKAKNKNGSNTNANASNKENYVPETRSSTSTETF
AEATADAPASTKAEPPQASSNRTRADRGKDRTTASAKEQKKSKEAAPAPAASKPAERVET
SESTIRQKKAEVTESCEDNLPQKRLAGTNVQRSVSSCSENSEGHVSESSLSEKSLTGDYV
EEKCNSVNSESQQESVKFQEELEKSNEAIVEAETILPTAESSEDISPAAVAPGNGEVEGC
LPVVDPVEPPSLADNGSRVTDALSKLNIFDDTPSFFTSPSFQQAPILKNKLDLEMRQSHL
PDLVNDIDGIQKASNTNEWEEAFKNVMMGNTQHMEEQLLQQQHLQQHQNLRHQLVLQQEE
FLRMQELQKRNNFATQINGPANDFLRAYELRAQANAIIQQQLLQQHAGENLFGGNMSKFF
DFHKSQPQSHHQYLNGHPPQINGNGAVPEPQRVAASLESNRLNSPFVENGLINSQQQQQQ
QQQQQKQRMMGMYEFMPPNTQSQQNRFTQNSIVDDDLGFDPFVETQKGLAELMENEVVQK
QSINNENPLPKLPPQPQVPPHPQLVDNLQRARMPPPGFNHVNTLGLGGASRLQLTSKIIP
FMNMPVNGVGNSGAQGQHQMPMGVNWNAPMGMHQNPGQPVGDSQLQHPMAHNKVYNNSDW
TSMDPAILSFRQYSSFPQNQIPPHPQQQQDLFLQHLAQQQNSQSGGFNNQAQQMLPMGMP
NSLLNGQQTQPPQVNANVQGMLEFLKSRQFV
Download sequence
Identical sequences Q9VKX1
7227.FBpp0079599 FBpp0079599 FBpp0079600 FBpp0079601 FBpp0079602 FBpp0079603 NP_723578.1.81976 NP_723579.1.81976 NP_723580.1.81976 NP_723581.1.81976 NP_723582.1.81976 FBpp0079599 FBpp0079600 FBpp0079601 FBpp0079602 FBpp0079603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]