SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079813 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079813
Domain Number 1 Region: 68-191
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.71e-29
Family Cold shock DNA-binding domain-like 0.0000375
Further Details:      
 
Domain Number 2 Region: 10-61
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000000161
Family ECR1 N-terminal domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079813   Gene: FBgn0032346   Transcript: FBtr0080226
Sequence length 204
Comment type=protein; loc=2L:complement(11122802..11123257,11123312..11123470); ID=FBpp0079813; name=Csl4-PA; parent=FBgn0032346,FBtr0080226; dbxref=GB_protein:AAF53074.1,FlyBase:FBpp0079813,FlyBase_Annotation_IDs:CG6249-PA,REFSEQ:NP_609492,GB_protein:AAF53074,FlyMine:FBpp0079813,modMine:FBpp0079813; MD5=f438056e039d78bfb55cf01ec2fbd655; length=204; release=r5.30; species=Dmel;
Sequence
MSEQQDETVVCLPGERLCRTEDSIVLGIGTYEQNGYIYASKSGIVNIEDSGDKCQVVSVH
KPGFHLTIPATGDVVTARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDRV
DIYKSFRPGDVILARVINQLEQSFLLTTAENELGVVIAYASDYRKTRVPMVPVGWSEMQC
PQTTIKEPRKVAKVLPESSINAVK
Download sequence
Identical sequences Q9VKJ4
FBpp0079813 FBpp0079813 FBpp0079813 7227.FBpp0079813 NP_609492.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]