The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
Sequence: |
FBpp0079914 |
Domain Number 1 |
Region: 348-629 |
Classification Level |
Classification |
E-value |
Superfamily |
Class II aaRS and biotin synthetases |
9.52e-91 |
Family |
Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain |
0.0000000941 |
Further Details: |
|
|
Domain Number 2 |
Region: 171-346 |
Classification Level |
Classification |
E-value |
Superfamily |
ThrRS/AlaRS common domain |
1.24e-53 |
Family |
Threonyl-tRNA synthetase (ThrRS), second 'additional' domain |
0.0000686 |
Further Details: |
|
|
Domain Number 3 |
Region: 631-739 |
Classification Level |
Classification |
E-value |
Superfamily |
Class II aaRS ABD-related |
3.02e-29 |
Family |
Anticodon-binding domain of Class II aaRS |
0.00093 |
Further Details: |
|
|
Domain Number 4 |
Region: 109-169 |
Classification Level |
Classification |
E-value |
Superfamily |
TGS-like |
0.000000000000019 |
Family |
TGS domain |
0.0048 |
Further Details: |
|
|
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
Molecular Function |
IC (bits) |
H-Score |
Cellular Component |
IC (bits) |
H-Score |
Biological Process |
IC (bits) |
H-Score |
External link(s) |
Protein: FBpp0079914 Gene: FBgn0027081 Transcript: FBtr0080332 |
Sequence length |
747 |
Comment |
type=protein; loc=2L:join(12103895..12104056,12104492..12104552,12104688..12105121,12105176..12106762); ID=FBpp0079914; name=Aats-thr-PA; parent=FBgn0027081,FBtr0080332; dbxref=GB_protein:AAF53166.2,FlyBase:FBpp0079914,FlyBase_Annotation_IDs:CG5353-PA,REFSEQ:NP_723725,GB_protein:AAF53166,FlyMine:FBpp0079914,modMine:FBpp0079914; MD5=0fec1876502d3cb9b57707ae2a47d2bb; length=747; release=r5.30; species=Dmel; |
Sequence |
MLKLAPQGGRYYSQISRICQWILPKIQTQSKPPKQQQQQQPQLKEQQQHSYATLAAKMKK
EKKEKPSGGGDTRKELSPLPKYIEERNVFWEKCKAEYEAELAAKKREPIKVTLPDGKQVD
ATSWETTPYEVARGISQGLADNTVISKVNGEVWDLDRVLEGNCTLQLLKFDDPEAQAVFW
HSSAHIMGEAMERIYGGHLCYGPPIENGFYYDMHLEGEGISTNDYGAMEGLVKQIVKEKQ
NFERLEMKKSDLLEMFKYNEFKVRILNEKVTTDRTTVYKCGSLIDLCRGPHVRHTGKVKA
LKITKNSSTYWEGKADAETLQRVYGISFPDPKQLKEWEKLQEEAAKRDHRKIGREQELFF
FHELSPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVISPNIYNAKLWMTSGHWQHYAE
NMFSFEAEKEKFALKPMNCPGHCLIFDNRNRSWRELPLRMADFGVLHRNELSGALTGLTR
VRRFQQDDAHIFCAPEQIKSEMKGCLEFLKYVYTIFGFSFQLVLSTRPDNYLGELEQWND
AEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLS
YIADDGEKKRPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQ
SVRDQLHDAGFMSEADCDAGDTMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKV
HGEVSVAELITKLQKIRDEFIANEDSF
|
Download sequence |
 |
Identical sequences |
Q9VKB0
7227.FBpp0079914 FBpp0079914 NP_001285868.1.81976 NP_723725.1.81976 FBpp0079914 FBpp0079914 |