SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080358 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080358
Domain Number 1 Region: 33-181
Classification Level Classification E-value
Superfamily L domain-like 2.31e-30
Family Internalin LRR domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080358   Gene: FBgn0028858   Transcript: FBtr0080800
Sequence length 182
Comment type=protein; loc=2L:15979572..15980120; ID=FBpp0080358; name=CG10839-PA; parent=FBgn0028858,FBtr0080800; dbxref=FlyBase:FBpp0080358,FlyBase_Annotation_IDs:CG10839-PA,GB_protein:AAF53496.1,REFSEQ:NP_609776,GB_protein:AAF53496,FlyMine:FBpp0080358,modMine:FBpp0080358; MD5=0d3d2a52067b6e169ed16c7ab57d40fe; length=182; release=r5.30; species=Dmel;
Sequence
MSKPTTLKDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMI
EKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVF
YISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLDGEPV
IR
Download sequence
Identical sequences Q9V3Q0
FBpp0080358 FBpp0294014 FBpp0080358 NP_001246039.1.81976 NP_001285969.1.81976 NP_609776.1.81976 FBpp0080358 7227.FBpp0080358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]