SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080685 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080685
Domain Number 1 Region: 45-116
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000196
Family HLH, helix-loop-helix DNA-binding domain 0.0064
Further Details:      
 
Domain Number 2 Region: 116-173
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000575
Family Hairy Orange domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080685   Gene: FBgn0032741   Transcript: FBtr0081141
Sequence length 507
Comment type=protein; loc=2L:join(19028057..19028105,19028801..19029112,19029301..19030463); ID=FBpp0080685; name=Side-PA; parent=FBgn0032741,FBtr0081141; dbxref=FlyBase:FBpp0080685,FlyBase_Annotation_IDs:CG10446-PA,GB_protein:AAF53741.1,REFSEQ:NP_523599,GB_protein:AAF53741,FlyMine:FBpp0080685,modMine:FBpp0080685; MD5=4aab8f3cbcf1da7935ac5c7c6c8abc38; length=507; release=r5.30; species=Dmel;
Sequence
MTAKRDKDYSKNKSAPGIGFTAAGSTNGSGIKSIGLVSSTQNVTSSQDISKRTNKPLMEK
RRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQRHRNLDDP
TVNKYRAGYTDCAREVARYLATPEPPPMGTMPTLAEPGSKARLLRHLDQCIAEIDVEICP
HSTAAFAESPSSSSCFDLNHGKKSQPEEHSLDYSSQDSNPVDYSKGLKMVAAEQRTLPVT
PAPQDENNNRGLQAQAQTPIPIQVQSQTQGQTSPHVDAVAPSELSYEEDRNKVCANVLEQ
YKQQLKAHVQQQPESANGVLVLPPHYVQLAAALGLSAQPLVDPIATRTDFERLIELQRVQ
PHLAGKLSPSFPGGLEAAHVAAAAAAYANSMAVAASAGASVAAMATSGAGTPTVHQERPA
SVAASVSSGVSMSELKSMPATQQSSPRSESGIGSNENEAPATSPRPQTSNAARQALRQRQ
EEEYHYMAQAAAAAAAAGQDESMWRPW
Download sequence
Identical sequences Q9VJ16
NP_523599.1.81976 FBpp0080685 FBpp0080685 FBpp0080685 7227.FBpp0080685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]