SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080921 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080921
Domain Number 1 Region: 222-269
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000864
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080921   Gene: FBgn0032877   Transcript: FBtr0081391
Sequence length 274
Comment type=protein; loc=2L:20682449..20683273; ID=FBpp0080921; name=CG2617-PA; parent=FBgn0032877,FBtr0081391; dbxref=FlyBase:FBpp0080921,FlyBase_Annotation_IDs:CG2617-PA,GB_protein:AAF53913.1,REFSEQ:NP_610050,GB_protein:AAF53913,FlyMine:FBpp0080921,modMine:FBpp0080921; MD5=eb01007b90bf40eb335105ea8d27017e; length=274; release=r5.30; species=Dmel;
Sequence
MLDALIRAAELVDLVLLRPLASVIDAVITGVYYFLWGSYLVGFCLVEGSRKGWNLLRCAV
RNINEGIRDLGLITLDVADYFYGGTKGGLKNVLDFGHCISRFICNLLIDLGDGILWLLML
LPRAILFLWDCLLDFVVHSIVAHGLSLLNSAFRASIGLALLLVLYMFRRYVYLMLIYLLQ
RGRIEISTKTQSVYLWTHHKLQHFIHNVWYVSENAGSASPERCVVCMAQSRNVVVMPCRH
LCLCKECSLQLVLLLEDRCPVCRHNITSFLSVYV
Download sequence
Identical sequences Q9VIK5
NP_001260636.1.81976 NP_610050.1.81976 FBpp0080921 FBpp0080921 FBpp0080921 7227.FBpp0080921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]