SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081021 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081021
Domain Number 1 Region: 758-1038
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.01e-75
Family Protein kinases, catalytic subunit 0.000000367
Further Details:      
 
Weak hits

Sequence:  FBpp0081021
Domain Number - Region: 458-523
Classification Level Classification E-value
Superfamily Cadherin-like 0.0628
Family Cadherin 0.016
Further Details:      
 
Domain Number - Region: 1124-1183
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0915
Family Fibronectin type III 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081021   Gene: FBgn0011829   Transcript: FBtr0081493
Sequence length 1235
Comment type=protein; loc=2L:complement(21183173..21184021,21184082..21184222,21184278..21185989,21186074..21186239,21188148..21188920,21195063..21195129); ID=FBpp0081021; name=Ret-PC; parent=FBgn0011829,FBtr0081493; dbxref=FlyBase:FBpp0081021,FlyBase_Annotation_IDs:CG14396-PC,GB_protein:AAN11101.1,REFSEQ:NP_724316,GB_protein:AAN11101; MD5=94b5203e554508f57a9e01a7a33d1cb9; length=1235; release=r5.30; species=Dmel;
Sequence
MESTTIVFVTLLTIITQRKHCAAVDVYFPTTSVKFNMPINEESESIFSKIPLAQFQVLRM
EDNRLASDYLYSLEQNPLLRINSSSGEIYMRTDYRSPNSSATFLVTAFPRDQPDHELLNV
SHLSLEVTPQPLEEYCSELEHICFWSSAQYTIAESHGPYRRKDFFEPVLIGALNSRAAKY
LCPHVSLEYSLNAGSSHFVLKQNRLYTRQTLDHDELNGLNAKAGQLQARITCTVKLSSRD
QRKFSRILDIKLLDRNDNGPKLQESSSKFDFYLEQPYFQADEEAGKKVIYVDKDTLEANA
HLVYAVHNDSHGLFRPDCHAYEADHTGRPHTIVSCQLRFSRNGVFRETPYCVSLEARDLT
IVSRVDAMSATANVCYHINLSKLHESEQELPQALPLRARQHRIFESEEFNGDSAGRSLSP
PTVDYDKDVSVYRSAASNFRVVQPDSFLDLMRLRSIRFDIVEDKLGAFGITSTSGIVFVK
NPQVLEEAPETIYFLNVTWIDQQRLSHVRVINVHLVHGRPENTSCELKVKSRSQTCAQIK
YQSQCVRYCGLATGGGSCQWRGSNSAMFGTRYGSCVPESRYCPDHVCDPLEELNPMACPQ
DCTPAGRIVGPHSSNENKRGIYSASGTCICEDNGKCSCAPLDEEPKMKKPRKRKNETEAE
PLLGVRRGTPPNQPLQDPMLLGVLNVAGFECDRSCMFFVITCPLLFVLLLLCLLIAQRKM
LQRRLGKQSMTTSSKQALPESGGGDFALMPLQSGFRFESGDAKWEFPREKLQLDTVLGEG
EFGQVLKGFATEIAGLPGITTVAVKMLKKGSNSVEYMALLSEFQLLQEVSHPNVIKLLGA
CTSSEAPLLIIEYARYGSLRSYLRLSRKIECAGVDFADGVEPVNVKMVLTFAWQICKGMA
YLSELKLVHRDLAARNVLLADGKICKISDFGLTRDVYEDDAYLKRSRDRVPVKWMAPESL
ADHVYTSKSDVWSFGVLCWELITLGASPYPGIAPQNLWSLLKTGYRMDRPENCSEAVYSI
VRTCWADEPNGRPSFKFLASEFEKLLGNNAKYIDLETNAVSNPLYCGDDSALITTELGEP
ESLQHLWSPPKIAYDIHDQATSYDQSEEEMPVTSTAPPGYDLPRPLLDATANGQVLRYEN
DLRFPLNIRKSSCTPSYSNMTSEPPATTSLPHYSVPVKRGRSYLDMTNKSLIPDNLDSRE
FEKHLSKTISFRFSSLLNLSETKEVSPGWQAEDAV
Download sequence
Identical sequences Q7KT06
NP_477044.1.81976 NP_724315.1.81976 NP_724316.1.81976 FBpp0081021 FBpp0081022 FBpp0081023 FBpp0081024 FBpp0081021 FBpp0081022 FBpp0081023 FBpp0081024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]