SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081691 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081691
Domain Number 1 Region: 425-669
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-32
Family Calponin-homology domain, CH-domain 0.002
Further Details:      
 
Domain Number 2 Region: 128-281,422-503
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.1e-19
Family HI0933 N-terminal domain-like 0.097
Further Details:      
 
Domain Number 3 Region: 1069-1099
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000491
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  FBpp0081691
Domain Number - Region: 1100-1131
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000314
Family LIM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081691   Gene: FBgn0053208   Transcript: FBtr0082213
Sequence length 4723
Comment type=protein; loc=3R:complement(5828157..5828162,5828220..5828416,5828475..5828575,5828632..5828709,5828769..5828973,5829096..5829372,5830132..5830164,5830378..5834358,5834418..5834576,5835026..5835094,5835455..5840548,5840712..5840827,5840897..5841317,5841385..5841648,5842012..5842548,5843295..5843561,5844219..5844280,5844664..5845157,5845231..5845363,5845427..5847104); ID=FBpp0081691; name=Mical-PD; parent=FBgn0053208,FBtr0082213; dbxref=FlyBase_Annotation_IDs:CG33208-PD,FlyBase:FBpp0081691,GB_protein:AAO41534,REFSEQ:NP_788623; MD5=fd5c66cc50270320cf8ab90c17ec49da; length=4723; release=r5.30; species=Dmel;
Sequence
MSRQHQRHHQQHHHLPPHQQPQQQMPQQQQQLTAQQQQQQQLLMAEHAAAAEAAELFDLL
CVATTMRQILALHRAMCEAVGLRPSPLNDFYPRLKAKVRSWKAQALWKKFDARAAHRVYG
KGAACTGTRVLVIGAGPCGLRTAIEAQLLGAKVVVLEKRDRITRNNVLHLWPFVITDLRN
LGAKKFYGKFCAGSIDHISIRQLQCMLLKVALLLGVEIHEGVSFDHAVEPSGDGGGWRAA
VTPADHPVSHYEFDVLIGADGKRNMLDFRRKEFRGKLAIAITANFINKKTEAEAKVEEIS
GVAFIFNQAFFKELYGKTGIDLENIVYYKDETHYFVMTAKKHSLIDKGVIIEDMADPGEL
LAPANVDTQKLHDYAREAAEFSTQYQMPNLEFAVNHYGKPDVAMFDFTSMFAAEMSCRVI
VRKGARLMQCLVGDSLLEPFWPTGSGCARGFLSSMDAAYAIKLWSNPQNSTLGVLAQRES
IYRLLNQTTPDTLQRDISAYTVDPATRYPNLNRESVNSWQVKHLVDTDDPSILEQTFMDT
HALQTPHLDTPGRRKRRSGDLLPQGATLLRWISAQLHSYQFIPELKEASDVFRNGRVLCA
LINRYRPDLIDYAATKDMSPVECNELSFAVLERELHIDRVMSAKQSLDLTELESRIWLNY
LDQICDLFRGEIPHIKHPKMDFSDLRQKYRINHTHAQPDFSKLLATKPKAKSPMQDAVDI
PTTVQRRSVLEEERAKRQRRHEQLLNIGGGAAGAAAGVAGSGTGTTTQGQNDTPRRSKKR
RQVDKTANIEERQQRLQEIEENRQERMSKRRQQRYHQTQNFYKSLQLLQAGKLLREGGEA
GVAEDGTPFEDYSIFLYRQQAPVFNDRVKDLERKLLFPDRERGDIPSALPRTADEQFSDR
IKNMEQRMTGRGGLGGDKKPKDLMRAIGKIDSNDWNVREIEKKIELSKKTEIHGPKGREK
VPKWSKEQFQARQHKMSKPQRQDSREAEKFKDIDQTIRNLDKQLKEGHNLDVGERGRNKV
ASIAGQFGKKDEANSDEKNAGSSNATTNTNNTVIPKSSSKVALAFKKQAASEKCRFCKQT
VYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYCTQHFRLPPKPLPQR
TNKARKSAAAQPASPAVPPTAGSVPTAAATSEHMDTTPPRDQVDLLETSRANASADAMSD
DEANVIDEHEWSGRNFLPESNNDSQSELSSSDESDTESDSEMFEEADDSPFGAQTLQLAS
DWIGKQYCEDSDDSDDFYDSSEGIADDGKDDTEGEEFKKARELRRQEVRLQPLPANLPTD
TETEKLKLNVDNKENMADRSSLKSGNSFESARSQPSTPLSTPTRVEMEQLERNAPRKFSS
EIEAISEKLYHMNNMVKMNKDLEVLAKENLVKSDILRKLTLKEKWLAENAAIAAGQKVTP
TPSATAPGLQPKSKFDEKFEKVVSPPQPVVEPKPKPVIDFNLDELKPRKPNFEERPKEQL
PRPESLKKPPQQKPKGSSTNVSRSNSLKSNASNGSPKVKKAPISNNSKMQIEGILGTLRK
IQSQNSSDQDEDMDVDEDVERKPNKELNSKLKEIQASSFAGTMDHIKSQLTMPTVSAQAP
PSMDLSKYFPNQKQEKSSTSSTNKNQVTLKDVNLAKYFPSSPAPQRRTVETVADRLKKSQ
TEAALAKTKLLEDQANNQAEKTKKEVEKEGESKKITKKVADSKAVPPKRQASLDTFSLRE
HQMDGALDLTKKKGPTKASAGVKKPAKSGSTTSVTKATATSKGKTIKIVKKIVPKGTKAK
KAAEAAQESAVVEAPPEKKPPKDEAERILDEILGDGEYRSPSSEYQRLFQDEKSPSDLSD
NIDRILEESGLDVELGLPKRSSKKLVKTKSLGEGDFDMKPSKERLTGVQNILKRFESMSS
VTSQNSDEQAAFKLRRMESTTSNLSSLTRSRESLVSVSDSMSDLEKTMDYLRNEWRNEAT
NFLQKKRDKFYAKKEEQEKESKILAKPDPLDNLPVQYRDSKLAKFFGLAASKSPENRKSP
IKKKKSPSKTPKVTKANNSLEELAKISNVRQTKKAQPKTLKPVEVKPLKPASPVPDDFEI
LDLLEKATEAKELERSKTKSPAVESISQTPKEAIVEISLPVEDIKNLPKTGCDKSSNSSR
RGSQSSLIMSRRHSEISLNEKLNQDALAALNQIEKEREAEQVDELFQSMVEEMEQEPQPT
AIVEPPEEDIDADSLCTTISKSPSAQPVTVVKRGSSEDQSIEKLFSHFSDEMLVNVEFDS
NDELVGITPRATLVSRNTEDRDYLDKLESLERDEETFQPVVGEKFIQENVQDEVDGLHFP
SRPQRRPKSSSSSSEPSLPVAPQRLKKKLSKLDPEDMPPSVQDLLQQVYQKNIQPELVEV
IPVEGKQTLRFPSMLAEEDVDEVDHSKEGIKKIETAPEEVRKVTEPEDVARVIPSPIKPS
ISQSNSLKSENSSGSSLVEIPKIITPPKSSSKENSSDWDMEKLPASPMPRRRLLPNQTPY
KAPSVASKESSLEWDMEKLPNSPMLPRRNKMRAISPSTNPVQLLNNLPSDVDDEAAQRRL
IEDFEQERRQALIKRDENFEAIAAEQRRRDSLQSSSNSSSKRSLPPPTPPMMASRRGTTQ
DTNRTQDTASRHEGTPPMFKKLDVDGSGTSMDSTSCSTRRSSFAFIELQDNKPVIVPMPK
KLKLPKPEPPRFVPEPVATDEPVPEVFQGRAWPKTQLEGEVDLGDSDNEDETEKLKKQLP
EYARSDSPPSAAFKNRKWPDGKTVFDKRAESLEEEDIFEGLLSPRKRGSQRFMDKPRSQS
PQPFKPLANSSRKSSKSFSDLKKGPSLQSLSAQSSQDTDTLSTTTTVATARPASYANYED
PMDASTQALLDRSKRLHNRKRDFVNERVVERNPYMRDVLRSTDRRDYDDVDEDLTSYRPR
HYASSTLNRFPNTTIRKSNNYDYLSPSSDYLSRRSYIPSASATSSYYPSTTRSSHLSDLF
RRRSPASGTVSALSGYGNKESCIGLALDRVGHLIESKCTWVRSTKVQTESESTSPDEVEL
NSATEISTDSEFDNDEIIRQAPKIFIDDTHLRKPTKVQIKSTMIGPNAASAGLHQKQLAA
REKGGSYLQKYQPQPPLPQFKPLVQVDPTLLIGSQRAPLQNPRPGDYLLNKTASTEGIAS
KKSLELKKRYLLGEPANGNKIQKSGSTSVLDSRIRSFQSNISECQKLLNPSSDISAGMRT
FLDRTKLGEGSQTTPGQTNELIRSATSNVINDLRVELRIQKTGSSHSTDNEKENVFVNCK
NELNKGMEYTDAVNATLLDQLARKSSPTTPTNKTVVEVIDLVTPEKPIDIIDLTALETPK
KQLVDGSAMDVDERLTPDSNKISELQQEVKEEPKPDVSRDVKECIPDILGHIKEGTGSKE
PGGEDQQSLLEQSDEEKRDSPEKDVAEHELYEPDSVQIQVPNIPWEKSKPEVMSTTGSSG
SICSSSDSSSIEDIQHYILESTTSPDTQTVGGKHNVPRLEVHDTSGALMQVDSLMIVNGK
YIGDPEDVKFLDMPANVIVPPAPALKTNELDMEDDQEAEAEPVTATPEPVECTVIEAERR
VTAPPPLPEMGPPKLKFDSKNENKIESLKNLPLIVESNVEHSQAVKPITLNLSNLARTPD
TPTTPTAHDSDKTPTGEILSRGSDSETEHTGTGQVLTETELSDWTADDCISENFVDLEFA
LNSNKGTIKRRKDRRRSGASKLPSGNEVIHELARQAPVVQMDGILSAIDIDDIEFMDTGS
EGSCAEAYSATNTALIQNRGYMEYIEAEPKKTTRKAAPPSSYPGNLPPLMTKRDEKLGVD
YIEQGAYIMHDDAKTPVNEVAPAMTQSLTDSITLNELDDDSMIISQTQPTTTEESEALTV
VTSPLDTSSPRVLDQFASMLAAGKGDSTPSSSEQQPKTSTVTSSSTGPNSSTTGNVSKEP
QEEDLQIQFEYVRALQQRISQISTQRRKSSKGEAPNLQLNSSAPVIESAEDPAKPAEEPL
VSMRPRTTSISGKVPEIPTLSSKLEEITKERTKQKDLIHDLVMDKLQSKKQLNAEKRLHR
SRQRSLLTSGYASGSSLSPTPKLAAACSPQDSNCSSQAHYHASTAEEAPKPPAERPLQKS
ATSTYVSPYRTVQAPTRSADLYKPRPFSEHIDSNALAGYKLGKTASFNGGKLGDFAKPIA
PARVNRGGGVATADIANISASTENLRSEARARARLKSNTELGLSPEEKMQLIRSRLHYDQ
NRSLKPKQLEEMPSGDLAARARKMSASKSVNDLAYMVGQQQQQQVEKDAVLQAKAADFTS
DPNLASGGQEKAGKTKSGRRPKDPERRKSLIQSLSSFFQKGSGSAASSSKEQGGAVAAVH
SEQSERPGTSSSGTPTISDAAGGGGGGGGVFSRFRISPKSKEKSKSCFDLRNFGFGDKDM
LVCNAASPAGATSASQKNHSQEYLNTTNNSRYRKQTNTAKPKPESFSSSSPQLYIHKPHH
LAAAHPSALDDQTPPPIPPLPLNYQRSDDESYANETREHKKQRAISKASRQAELKRLRIA
QEIQREQEEIEVQLKDLEARGVLIEKALRGEAQNIENLDATKDNDEKLLKELLEIWRNIT
ALKKRDEELTIRQQELQLEYRHAQLKEELNLRLSCNKLDKSSADVAAEGAILNEMLEIVA
KRAALRPTASQLDLTAAGSASTSAEATGIKLTGQPHDHEESII
Download sequence
Identical sequences Q86BA1
FBpp0081687 FBpp0081688 FBpp0081689 FBpp0081690 FBpp0081691 FBpp0081687 FBpp0081688 FBpp0081689 FBpp0081690 FBpp0081691 NP_788622.1.81976 NP_788623.1.81976 NP_788624.1.81976 NP_788625.1.81976 7227.FBpp0081688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]