SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081723 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081723
Domain Number 1 Region: 60-129
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000824
Family HLH, helix-loop-helix DNA-binding domain 0.0043
Further Details:      
 
Domain Number 2 Region: 126-166
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000301
Family Hairy Orange domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081723   Gene: FBgn0259938   Transcript: FBtr0082246
Sequence length 698
Comment type=protein; loc=3R:join(6215101..6215159,6222419..6222542,6223085..6223406,6223469..6225060); ID=FBpp0081723; name=cwo-PA; parent=FBgn0259938,FBtr0082246; dbxref=FlyBase:FBpp0081723,FlyBase_Annotation_IDs:CG17100-PA,GB_protein:AAF54527.2,REFSEQ:NP_524775,GB_protein:AAF54527,FlyMine:FBpp0081723,modMine:FBpp0081723; MD5=f96d043f9ac82cbe4e7ebeddc9721567; length=698; release=r5.30; species=Dmel;
Sequence
MEPYWNETNGHAAHPVKYESEAAVSSFPYCTESSLNFSTSATAYSEDDAEYATGRRNKTS
RQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKTEIIEMAIRHLKHLQSE
CQQKESDYRSGYMDCMKEAAKFLYDVHMQDFCHRLLGRLQEHIDEMFKTDCYKSTRSCHM
PDNVSASSGSPHQAYHPPLCHLRDMLATSASDVEHSQDHNDVKDLSFRNHLNQLQRSQQA
AAAAAVAAAAVAVANGSSPASNAGVDSKVPLTNGGGTGGAPPAADNVPSNSTGSGSAAAC
AGGNSNSSGSNSSNAASSTICPPAGGSCPAKVTPLAAHQQPHQAPVITSTAPHHHHHHTD
SSHHDFESSREPILHTDTSNMHSPPPRDLLLQQHPHLAHSHHTQDSLMSVRMRNYSESSH
EIEHNNNYKYKNHIKERFVHELHDEETSSEHCPVAAHLQSDHSHLQALSEHSKDGTEPEI
APIMAKKRKLAEAAANGEIPLEVHTESSNAGASSANRLDKPSPSFNFSDIKDIKAELHNG
NSNSSPLLAKLSAVAAAGGQLSTPSSTTAPLPPRHTFTVPIFALHGQGNYYVPLNVDYNA
LVPFLNGMDLLEKSYTSMPVVHPININVNFMPSSPSASLLAAAAAAAVAVGKQQQQQAVV
AAGAGLPLSTNSAAAQAAAVAAAAVAKAKLEQAMNQSW
Download sequence
Identical sequences Q9VGZ5
FBpp0081723 FBpp0081723 FBpp0081723 NP_524775.1.81976 7227.FBpp0081723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]