SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082624 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082624
Domain Number 1 Region: 173-268,301-360
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000299
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 
Domain Number 2 Region: 380-466
Classification Level Classification E-value
Superfamily TPR-like 0.0000114
Family Tetratricopeptide repeat (TPR) 0.046
Further Details:      
 
Domain Number 3 Region: 79-157
Classification Level Classification E-value
Superfamily TPR-like 0.000091
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082624   Gene: FBgn0038358   Transcript: FBtr0083170
Sequence length 570
Comment type=protein; loc=3R:join(11600218..11600220,11600282..11600446,11601609..11602493,11602556..11603016,11603076..11603274); ID=FBpp0082624; name=CG4525-PA; parent=FBgn0038358,FBtr0083170; dbxref=FlyBase:FBpp0082624,FlyBase_Annotation_IDs:CG4525-PA,GB_protein:AAF55219.1,REFSEQ:NP_650486,GB_protein:AAF55219,FlyMine:FBpp0082624,modMine:FBpp0082624; MD5=d1728204c9ec0f4773edd089ab4635da; length=570; release=r5.30; species=Dmel;
Sequence
MILSRGKTDSASSRNASGGPGSGLGVGRQARKTPAPASLEDFIIRRDYTGARAFLEFAND
DEDEEEGAHGSKQSQVDQWIAFCNFHLGDYQQALAQYKAIQQGSSTPDGKLDLNLAVCMF
YLGLYEEAQQLMANAADNPLKQRLLFHLAHKLGNEEEWSQLQEELQDSSSLEQQLSLASM
HYMRAHYQEAIDVYKRVLVDNKEYQAINVYLALCFYKLDYYDMSQEVLDVYLSQHGDSTI
AINLKACNRFRLFNGRVAEQEIKNIADNGTFGADLLRHNLVVFRNGEGALRVLPGLLNII
PEARLNLAIYYLKQGDVQEAHALMKELQPTSPHEYILKGVVHAALGQQLGSKEHIKTAQQ
NLHLVGSSATECDTIPGRQSMASAFFLYEQFEEVLVYMNSIRSYFVNDDVFNYNFAQAKC
ATGYYKEAEELLMQISDMDIKNQHTYCMILAKCHIHCGHPELAWNVFITRDTNAEAFILL
QLIANECYKCAEFWVAAKAFDMLEKLDPSPENWEGKRGACAGVLFALCTKAQRGRPGGGI
SEVIGILRDSSNSQAEAMIKTIRKHINHFK
Download sequence
Identical sequences Q9VF41
FBpp0082624 7227.FBpp0082624 FBpp0082624 FR730 NP_650486.1.81976 FBpp0082624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]