SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082729 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082729
Domain Number 1 Region: 38-142
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.3e-28
Family Single strand DNA-binding domain, SSB 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082729   Gene: FBgn0010438   Transcript: FBtr0083277
Sequence length 146
Comment type=protein; loc=3R:complement(12030036..12030258,12030616..12030724,12030783..12030870,12030938..12030958); ID=FBpp0082729; name=mtSSB-PA; parent=FBgn0010438,FBtr0083277; dbxref=FlyBase:FBpp0082729,FlyBase_Annotation_IDs:CG4337-PA,GB_protein:AAF55287.2,REFSEQ:NP_536744,GB_protein:AAF55287; MD5=fd2b7a04f19aa1a738316f13e4cf635c; length=146; release=r5.30; species=Dmel;
Sequence
MQHTRRMLNPLLTGLRNLPARGATTTTAAAPAKVEKTVNTVTILGRVGADPQLRGSQEHP
VVTFSVATHTNYKYENGDWAQRTDWHRVVVFKPNLRDTVLEYLKKGQRTMVQGKITYGEI
TDQQGNQKTSTSIIADDVLFFRDANN
Download sequence
Identical sequences P54622
NP_536744.2.81976 FBpp0082729 FBpp0082729 FBpp0099503 FBpp0082729 FBpp0099503 7227.FBpp0099503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]