SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082888 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082888
Domain Number 1 Region: 162-427
Classification Level Classification E-value
Superfamily L domain-like 7.48e-61
Family Internalin LRR domain 0.013
Further Details:      
 
Domain Number 2 Region: 363-621
Classification Level Classification E-value
Superfamily L domain-like 1.73e-48
Family Ngr ectodomain-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082888   Gene: FBgn0038504   Transcript: FBtr0083447
Sequence length 641
Comment type=protein; loc=3R:complement(13223058..13224502,13224741..13225221); ID=FBpp0082888; name=Sur-8-PA; parent=FBgn0038504,FBtr0083447; dbxref=FlyBase:FBpp0082888,FlyBase_Annotation_IDs:CG5407-PA,GB_protein:AAF55415.2,REFSEQ:NP_732231,GB_protein:AAF55415,REFSEQ:NP_732231,GB_protein:AAF55415,FlyMine:FBpp0082888,modMine:FBpp0082888; MD5=97e287e3f7fc8a588a504d01dc24e470; length=641; release=r5.30; species=Dmel;
Sequence
MNLCSSGATASTTSLSSTGQAERSGGVPGGGAEGGGGSGNSGGGGKTSNGSAEAPTLCFA
GGSGTAGAIAGTEELSNANSPANGAGGATGSTGSGQQPTGSNGHSHLHNENNANMPPETR
PKMVTVKHPESNKPKPTTKKSKPIQADQDVIKALQRCRDEGIKRLDLSKSSITVIPSTVK
ECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNK
LAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNL
TTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVP
ATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSI
NLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDD
IMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQT
NQITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALC
QNLKYLNIDKCPLSTIPPEIQAGGPSLVLQWLKMHSPYRQM
Download sequence
Identical sequences A0A0B4KHN4 Q9VEK6
7227.FBpp0082889 FBpp0082888 FBpp0082889 FBpp0306061 FBpp0082888 FBpp0082889 NP_001262664.1.81976 NP_650620.3.81976 NP_732231.2.81976 FBpp0082888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]