SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083154 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083154
Domain Number 1 Region: 440-565
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000151
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 332-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000176
Family EGF-type module 0.016
Further Details:      
 
Domain Number 3 Region: 291-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000274
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 377-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000193
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083154   Gene: FBgn0000463   Transcript: FBtr0083740
Sequence length 833
Comment type=protein; loc=3R:complement(15130550..15132311,15134429..15134483,15137538..15137786,15141728..15141794,15145540..15145851,15151204..15151260); ID=FBpp0083154; name=Dl-PB; parent=FBgn0000463,FBtr0083740; dbxref=FlyBase:FBpp0083154,FlyBase_Annotation_IDs:CG3619-PB,GB_protein:AAN13798.1,REFSEQ:NP_732412,GB_protein:AAN13798; MD5=b3e984d4c399e9db113b0227208cf84a; length=833; release=r5.30; species=Dmel;
Sequence
MHWIKCLLTAFICFTVIVQVHSSGSFELRLKYFSNDHGRDNEGRCCSGESDGATGKCLGS
CKTRFRVCLKHYQATIDTTSQCTYGDVITPILGENSVNLTDAQRFQNKGFTNPIQFPFSF
SWPGTFSLIVEAWHDTNNSGNARTNKLLIQRLLVQQVLEVSSEWKTNKSESQYTSLEYDF
RVTCDLNYYGSGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIPKCAKGCEHGHC
DKPNQCVCQLGWKGALCNECVLEPNCIHGTCNKPWTCICNEGWGGLYCNQDLNYCTNHRP
CKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKC
HCANGWSGKMCEEKVLTCSDKPCHQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLD
NCSPNPCINGGSCQPSGKCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCV
PGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHN
GGTCMNRVNSFECVCANGFRGKQCDEESYDSVTFDAHQYGATTQARADGLTNAQVVLIAV
FSVAMPLVAVIAACVVFCMKRKRKRAQEKDDAEARKQNEQNAVATMHHNGSGVGVALASA
SLGGKTGSNSGLTFDGGNPNIIKNTWDKSVNNICASAAAAAAAAAAADECLMYGGYVASV
ADNNNANSDFCVAPLQRAKSQKQLNTDPTLMHRGSPAGSSAKGASGGGPGAAEGKRISVL
GEGSYCSQRWPSLAAAGVAGACSSQLMAAASVAGSGAGTAQQQRSVVCGTPHM
Download sequence
Identical sequences A4V346 P10041
FBpp0083153 FBpp0083154 FBpp0293200 FBpp0083153 FBpp0083154 NP_001247193.1.81976 NP_477264.1.81976 NP_732412.1.81976 7227.FBpp0083154 FBpp0083153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]