SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083987 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083987
Domain Number 1 Region: 1001-1208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-26
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 2 Region: 1222-1389
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.76e-16
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 3 Region: 1482-1505,1574-1729
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000109
Family Laminin G-like module 0.042
Further Details:      
 
Domain Number 4 Region: 90-253
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000274
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 5 Region: 685-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000147
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 6 Region: 800-842
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000157
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 1832-1869
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000438
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 8 Region: 1793-1836
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000682
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 9 Region: 425-462
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000712
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 10 Region: 723-765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 11 Region: 902-945
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000013
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 12 Region: 761-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000135
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 13 Region: 1950-1994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000153
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 14 Region: 386-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000089
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 15 Region: 608-654
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000105
Family EGF-type module 0.016
Further Details:      
 
Domain Number 16 Region: 349-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000019
Family EGF-type module 0.039
Further Details:      
 
Domain Number 17 Region: 646-682
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000011
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 18 Region: 305-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000116
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 19 Region: 465-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 20 Region: 1873-1917
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000166
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 21 Region: 267-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000401
Family EGF-type module 0.024
Further Details:      
 
Domain Number 22 Region: 1760-1799
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000456
Family EGF-type module 0.013
Further Details:      
 
Domain Number 23 Region: 1913-1954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000158
Family EGF-type module 0.016
Further Details:      
 
Domain Number 24 Region: 1989-2027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000785
Family EGF-type module 0.013
Further Details:      
 
Domain Number 25 Region: 2029-2071
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000146
Family EGF-type module 0.01
Further Details:      
 
Domain Number 26 Region: 940-980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000255
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 27 Region: 1483-1541
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000659
Family Growth factor receptor domain 0.0084
Further Details:      
 
Weak hits

Sequence:  FBpp0083987
Domain Number - Region: 549-580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000238
Family EGF-type module 0.0085
Further Details:      
 
Domain Number - Region: 882-906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000858
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 838-858
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0142
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083987   Gene: FBgn0259685   Transcript: FBtr0084603
Sequence length 2146
Comment type=protein; loc=3R:join(20121349..20121586,20130923..20131267,20131613..20132605,20133918..20134450,20134747..20135291,20135352..20135457,20135523..20135717,20135783..20136554,20136620..20136802,20136870..20138630,20138699..20138823,20138885..20139298,20139371..20139601); ID=FBpp0083987; name=crb-PA; parent=FBgn0259685,FBtr0084603; dbxref=FlyBase:FBpp0083987,FlyBase_Annotation_IDs:CG6383-PA,GB_protein:AAF56276.1,REFSEQ:NP_524480,GB_protein:AAF56276,FlyMine:FBpp0083987,modMine:FBpp0083987; MD5=59c392d463f25694d5492ded19b1777f; length=2146; release=r5.30; species=Dmel;
Sequence
MAKIANASLSQQQKQRQAETATTTTTTVAASVETATTTARSRDRTKSAAQITSHLLKRAI
SVYSSPQWIPLFILIYLATDVASVAVPTKEAYFNGSTYLRLTTPMPIWDHSAISFRSCRG
GEILAQQYNKNSIVISVLNDFLQISLAGPAVHGPNNRLDVKLPYQLLDNRWHTLQFKYEY
GNLYLHVDRAASIFANSTYNSQFLTNQDIGYKDAILILGNSFSGCLLDGPGLQFVNNSTV
QNVVFGHCPLTPGPCSDHDLFTRLPDNFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNC
QKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGA
CVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGA
FCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDK
PIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSGYNCQTSTGDGASAL
ALTPINCNATNGKCLNGGTCSMNGTHCYCAVGYSGDRCEKAENCSPLNCQEPMVCVQNQC
LCPENKVCNQCATQPCQNGGECVDLPNGDYECKCTRGWTGRTCGNDVDECTLHPKICGNG
ICKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKINAYECVCQPGYEGENC
EVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQL
GGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKCLDRVKDYFCDCHNGYKGKNCEQDIN
ECESNPCQYNGNCLERSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCE
ININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPCQRGTCYDQID
DYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEK
TTTLSMVATSLISVTTEREEGYDINLQFRTTLPNGVLAFGTTGEKNEPVSYILELINGRL
NLHSSLLNKWEGVFIGSKLNDSNWHKVFVAINTSHLVLSANDEQAIFPVGSYETANNSQP
SFPRTYLGGTIPNLKSYLRHLTHQPSAFVGCMQDIMVNGKWIFPDEQDANISYTKLENVQ
SGCPRTEQCKPNPCHSNGECTDLWHTFACHCPRPFFGHTCQHNMTAATFGHENTTHSAVI
VETTDVARRAIRSILDISMFIRTREPTGQVFYLGTDPRKAPTKNIGDSYVAAKLHGGELL
VKMQFSGTPEAYTVGGQKLDNGYNHLIEVVRNQTLVQVKLNGTEYFRKTLSTTGLLDAQV
LYLGGPAPTRESLLGATTEPGIIPVPGAGIPIEDTTVPKEADDSRDYFKGIIQDVKVSNG
SLNLIVEMYSLNVTDVQVNAKPLGAVTIDRASVLPGEVSDDLCRKNPCLHNAECRNTWND
YTCKCPNGYKGKNCQEIEFCQHVTCPGQSLCQNLDDGYECVTNTTFTGQERSPLAFFYFQ
EQQSDDIVSEASPKQTLKPVIDIAFRTRAGGTLLYIDNVDGFFEIGVNGGRVTITWKLSA
LHFGESARFEKENTDGEWSRIYLRAHNSKLEGGWKGWESMVDPTPAFSTDIDQAAFQSLI
ATSTQVYLGGMPESRQARGSTLSAQQGSQFKGCVGEARVGDLLLPYFSMAELYSRTNVSV
QQKAQFRLNATRPEEGCILCFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLN
TECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPE
DYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIPFCEITP
CDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTG
FEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSN
GGRCVESCGAKPDYYCECPEGFAGKNCTAPITAKEDGPSTTDIAIIVIPVVVVLLLIAGA
LLGTFLVMARNKRATRGTYSPSAQEYCNPRLEMDNVLKPPPEERLI
Download sequence
Identical sequences P10040
FBpp0083987 NP_524480.2.81976 FBpp0083987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]