SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084070 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084070
Domain Number 1 Region: 138-337
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.27e-53
Family Astacin 0.00016
Further Details:      
 
Domain Number 2 Region: 801-909
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-35
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 3 Region: 488-586
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-35
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 4 Region: 634-751
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-30
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 5 Region: 909-1026
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-28
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 6 Region: 335-361,388-480
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-22
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 7 Region: 587-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000243
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 8 Region: 751-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000234
Family EGF-type module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084070   Gene: FBgn0003719   Transcript: FBtr0084691
Sequence length 1067
Comment type=protein; loc=3R:join(20575518..20575715,20575778..20575839,20575985..20576329,20576384..20577204,20577256..20577517,20577571..20578139,20578196..20579142); ID=FBpp0084070; name=tld-PA; parent=FBgn0003719,FBtr0084691; dbxref=GB_protein:AAF56329.1,FlyBase:FBpp0084070,FlyBase_Annotation_IDs:CG6868-PA,GB_protein:AAF56329.2,REFSEQ:NP_524487,GB_protein:AAF56329,FlyMine:FBpp0084070,modMine:FBpp0084070; MD5=14eb76ccfd62c80f78390a3357c36734; length=1067; release=r5.30; species=Dmel;
Sequence
MKGMRLMPMKMKAKLVVLSVGALWMMMFFLVDYAEGRRLSQLPESECDFDFKEQPEDFFG
ILDSSLVPPKEPKDDIYQLKTTRQHSGRRRKQSHKSQNKAALRLPPPFLWTDDAVDVLQH
SHSPTLNGQPIQRRRRAVTVRKERTWDYGVIPYEIDTIFSGAHKALFKQAMRHWENFTCI
KFVERDPNLHANYIYFTVKNCGCCSFLGKNGNGRQPISIGRNCEKFGIIIHELGHTIGFH
HEHARGDRDKHIVINKGNIMRGQEYNFDVLSPEEVDLPLLPYDLNSIMHYAKNSFSKSPY
LDTITPIGIPPGTHLELGQRKRLSRGDIVQANLLYKCASCGRTYQQNSGHIVSPHFIYSG
NGVLSEFEGSGDAGEDPSAESEFDASLTNCEWRITATNGEKVILHLQQLHLMSSDDCTQD
YLEIRDGYWHKSPLVRRICGNVSGEVITTQTSRMLLNYVNRNAAKGYRGFKARFEVVCGG
DLKLTKDQSIDSPNYPMDYMPDKECVWRITAPDNHQVALKFQSFELEKHDGCAYDFVEIR
DGNHSDSRLIGRFCGDKLPPNIKTRSNQMYIRFVSDSSVQKLGFSAALMLDVDECKFTDH
GCQHLCINTLGSYQCGCRAGYELQANGKTCEDACGGVVDATKSNGSLYSPSYPDVYPNSK
QCVWEVVAPPNHAVFLNFSHFDLEGTRFHYTKCNYDYLIIYSKMRDNRLKKIGIYCGHEL
PPVVNSEQSILRLEFYSDRTVQRSGFVAKFVIDVDECSMNNGGCQHRCRNTFGSYQCSCR
NGYTLAENGHNCTETRCKFEITTSYGVLQSPNYPEDYPRNIYCYWHFQTVLGHRIQLTFH
DFEVESHQECIYDYVAIYDGRSENSSTLGIYCGGREPYAVIASTNEMFMVLATDAGLQRK
GFKATFVSECGGYLRATNHSQTFYSHPRYGSRPYKRNMYCDWRIQADPESSVKIRFLHFE
IEYSERCDYDYLEITEEGYSMNTIHGRFCGKHKPPIIISNSDTLLLRFQTDESNSLRGFA
ISFMAVDPPEDSVGEDFDAVTPFPGYLKSMYSSETGSDHLLPPSRLI
Download sequence
Identical sequences P25723
FBpp0084070 FBpp0084070 FBpp0084070 NP_524487.2.81976 7227.FBpp0084070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]