SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084594 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084594
Domain Number 1 Region: 422-515
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.08e-33
Family ets domain 0.0000433
Further Details:      
 
Domain Number 2 Region: 245-344
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.1e-19
Family Pointed domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084594   Gene: FBgn0005659   Transcript: FBtr0085224
Sequence length 518
Comment type=protein; loc=3R:join(23562814..23562855,23569473..23570253,23570314..23570474,23572135..23572294,23572385..23572797); ID=FBpp0084594; name=Ets98B-PA; parent=FBgn0005659,FBtr0085224; dbxref=GB_protein:AAF56746.1,FlyBase:FBpp0084594,FlyBase_Annotation_IDs:CG5583-PA,GB_protein:AAF56746.2,REFSEQ:NP_524535,GB_protein:AAF56746,FlyMine:FBpp0084594,modMine:FBpp0084594; MD5=1d6907c774f10d55a72dec665caaed72; length=518; release=r5.30; species=Dmel;
Sequence
MEYEKMLYMPAASEMPHSPQLKPHQFQAHTPTDQYSSYADNFDLSLLPQESASIPTTVFQ
YNAPQIKVECAWDSQPIQQQQQPTAPYTNPSSHQLIPPPAYPHSAYPSPQSSPLQSEFAA
YGLGRFGGSYDSLNSPSPSLEAVSIKQELHILPPSPPESNCETPSPRSSCGESIKAEPLD
ADIESLIDLNSLLQQQSLQSPQNLQDTKPDHQLLRECLEDTSFQKRHNLKPLALESFIGG
LAEVRGDFEPVISLALEHAKREADAICAELQISQDPNGWSPAQVHAWLRSTLAQFRLPPV
ADLELHFCENGAALALLSEEEFVRRLPESGSTLHAQLEIWKMAYADQPAHQQHSQQSAST
DHWPASYAMPHLDLDYNEDSEDDDDMEADAQVAPLNGSTTSPPATNASNGGTATVKRPNG
GRTGGGGSHIHLWQFLKELLASPQVNGTAIRWIDRSKGIFKIEDSVRVAKLWGRRKNRPA
MNYDKLSRSIRQYYKKGIMKKTERSQRLVYQFCHPYSQ
Download sequence
Identical sequences B7FNJ4 P29775
7227.FBpp0084594 FBpp0084594 FBpp0084594 FBpp0084594 NP_524535.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]