SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084798 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084798
Domain Number 1 Region: 597-658
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000243
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084798   Gene: FBgn0039668   Transcript: FBtr0085430
Sequence length 804
Comment type=protein; loc=3R:complement(25325364..25325714,25325780..25325980,25326039..25326220,25326441..25326615,25326673..25327210,25327425..25327995,25328451..25328847); ID=FBpp0084798; name=Trc8-PB; parent=FBgn0039668,FBtr0085430; dbxref=FlyBase:FBpp0084798,FlyBase_Annotation_IDs:CG2304-PB,GB_protein:AAN14174.1,REFSEQ:NP_733293,GB_protein:AAN14174,FlyMine:FBpp0084798,modMine:FBpp0084798; MD5=21369c89b1753f2db47e07894bf8f863; length=804; release=r5.30; species=Dmel;
Sequence
MSVRTKVLGLVDVMMRVPPVMVIDEILKMDMGMQSWLYPDKDKASGALATPTEAPAVPSG
QDPFTSIKELFSHMTTSAQSVLEQSIEKASEAAKTHGMLSSGFNSLMNELSKDQTLADVL
STTTVKFVLCVFAFLSAACIFMLWTRHLVMVYMFLTSLGLTFLSYWSNVSALALTERSPS
MVEDLMSLNTTRLLDSGGVVMSLAPHLMAQWFMGMLFAYIHLGPRFEHVQRSMPIIFASP
ILLAMLPLPAKVVQHLPVVAVFTPIILTKITLMQSAMEASRTVYNGYQYAMNFVSNFGLS
ALIENEWQRLNVPNVLRVFWTIRLIQGGYALATTESDEPLDLMTATQKLLVDGCETMTAV
LGMTGVISMFCHYIGRGFQWYLLTYDDEEKSLGTVSAVLFYILALQTGLTSLSPDKRFIR
LCRNLCLLMTALLHFLHNIVSPILMSLSAARNPSRKRHVRALSVCAFLVVLSVSLLYHLW
SQQSISTWLLAVTAFSVEVVVKVLVSLATYTLFLLDARRQFFWEKLDDYLYYVRAFGNSV
EFCFGILLFINGAWILIFESGGGIRAIMMCIHAYFNIWCEARAGWSVFMKRRSAVHKISA
LPEATPAQLQAFDDVCAICYQEMYSAKITRCRHFFHGVCLRKWLYVQDRCPLCHEIMMYT
DKADENAPEAEPAPAAQAEQPMRIYPRDDANNAAAQRRSPERAPVEASEQAPATSSSSAA
ATIGAEAVSAIVESAAAVGEARSLVSVASSSSATHRISASGSSDSSYMTASAQSPPPTAT
SAAAVATAAASNTTHMFRMSQDQQ
Download sequence
Identical sequences A4V3L3
FBpp0084797 FBpp0084798 FBpp0305390 FBpp0084797 FBpp0084798 NP_001263070.1.81976 NP_733292.1.81976 NP_733293.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]