SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085046 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085046
Domain Number 1 Region: 172-259
Classification Level Classification E-value
Superfamily TPR-like 0.0000531
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085046   Gene: FBgn0051524   Transcript: FBtr0085684
Sequence length 536
Comment type=protein; loc=3R:complement(26338118..26338224,26338286..26338451,26338513..26339162,26339222..26339421,26339476..26339626,26339679..26339821,26339875..26340068); ID=FBpp0085046; name=CG31524-PA; parent=FBgn0051524,FBtr0085684; dbxref=FlyBase:FBpp0085046,FlyBase_Annotation_IDs:CG31524-PA,GB_protein:AAN14239.1,REFSEQ:NP_733379,GB_protein:AAN14239,FlyMine:FBpp0085046,modMine:FBpp0085046; MD5=2bba1b21cb97a3dabce2985ac8c3099f; length=536; release=r5.30; species=Dmel;
Sequence
MPVLKLLFVVIFFLSLSMGQIEATQPRFARSVVNMDDLLNMEDDLVSKLEGYAEKLSYKA
NTIRWGIQQMREQLDKSKKEQSFDLFNRYSFIRHMQADWLMWKQYLDKPVIRDELNYKQM
DNLRMPQELDLFDASEAIRRMQATYAMLSNDIAEGFLDGVQYTSKLSPIDCLAMGRHLMN
QSRWTIAEQWILAGIKAQDRKGPQTEMILLRGPTKAELFRTLGKVRFERRNEEGALKAYQ
AALKHSPHDLEIFQEYQNLKRRVLTLSPSEPIREEPNDDIEEMELPPCCSGRCEGPRKLN
RLYCVYNCVTAPFLRLAPIKTEILSVDPFVILLHDMVSHKEGALIRSSSKNQILPSETVN
AANEFEIAKFRTSKSVWFDSDANEATLKLTQRLGEATGLDMKHSEPFQVINYGIGGVFES
HFDTSLADEDRFVNGYIDRLATTLFYLNDVPQGGATHFPGLNITVFPKFGTVLMWYNLHT
EGMLHVRTMHTGCPVIVGSKWVVSKWIDDKGQEFRRPCLRSRLDSKYLSSIEKIII
Download sequence
Identical sequences Q8IMI2
FBpp0085046 FBpp0110159 NP_733379.2.81976 7227.FBpp0085046 FBpp0085046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]