SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085156 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0085156
Domain Number - Region: 72-146
Classification Level Classification E-value
Superfamily NHL repeat 0.00785
Family NHL repeat 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085156   Gene: FBgn0003268   Transcript: FBtr0085795
Sequence length 2089
Comment type=protein; loc=3R:join(27406745..27406840,27406903..27407240,27407330..27407677,27407738..27407937,27408002..27408210,27408266..27408966,27409027..27410294,27410356..27410750,27410811..27411319,27411378..27411747,27411805..27412069,27412140..27412965,27413025..27413658,27413719..27413829); ID=FBpp0085156; name=rod-PA; parent=FBgn0003268,FBtr0085795; dbxref=FlyBase:FBpp0085156,FlyBase_Annotation_IDs:CG1569-PA,GB_protein:AAF57162.2,REFSEQ:NP_476705,GB_protein:AAF57162,FlyMine:FBpp0085156,modMine:FBpp0085156; MD5=e65bc4cfd797167f7451cbee7b65b383; length=2089; release=r5.30; species=Dmel;
Sequence
MWSNFEASSLEDETISNIFSSRGIFQISSEEEVNKYPDVMASVQCGKMVIGIDKSLLLLE
DELVAKCSFLAFGAAIEAIAISSSGNLIVCGLSDGEVHGVFIKGLLLFSVAVNLEDVSLT
GGTFRSIHQLDQRFYFTCKNGSIYSLSDIDETCLETLGNMSLNENETIACEKALLEDVTI
QRLSKGRSSCSVDCAVLLKRLLTGNISAENNQDDLEAQPGLVITGDQSTMNFRNAANDVT
RINLPAQYGSLKQIFNLEHYIIALTDSGHLVEICPYTRTVYMCQTTQQKNLLIEDLLVME
CSEDNIELLVLTKSTAEGRFIKIVEYPTLNVKNEVEVPDHAWLVRQPKCAVNLYYLAAKE
VNQSSIPSVVEMMLVSETDPSDRFKKLICKGRLEEAEEFGKQFELCLQPIYEAKAKRILV
ELCNSNSQNVDTKFQDLLQLLSQVESKAFIKSHRMINLNSRHILERYLHEVKKRLTFEDD
EEDMLEIDEQLHRLKTLAIIDPYECNTDWQKFIYDNNLVRMVKSLFNTDMPTACLIWRRH
SSSILPLLNEDELRTLLGFIPSNTKPFNVVQWLRQFIPMVSNTHPSIMPFITDWSIEMTR
NLQYSPHWPDIGLEFCTKILDIFEEIQFTYSDVRRQQERNVGKLRDLVNALQDLSVLKTN
YNMGFTLDNYMQDSIDATALSILQHVQLDKLQRLVKNFMYPIFQEKGRQPLDVIKQYISQ
LVASRLSSSSWLDRAMACIELLHNEDSRLECALSVLQNAPVPWPDTLAPLIRLRASTHPL
AVKINAEYEIQVIKIMKVKYGWPADSSDINLELFMMRIVKLNLPDMLDDISALTKAAPEL
STSANFNCCYQMARRGQVEMAYEFFKKLNGEKNSKSAKEVVEIMANILENSSSASFESDI
KVQEHLNVLELFKLFLPHVESVYERRYLVIKHRFRLRKFGILLSCSSELIPLHRRHCLLD
EAIERIIERAQATLNVSAFIASEISELCTALGLPKVFGLHRICQRIGCLPLSCALAYHVV
SFVDCVPANAGEFVNLALELLVQQIESAKGKNQETASSLQLINENDPLSFYLAYELLTSA
LLHESSRRHDLVELIKYIRVAVIHYPLDAIKSHYDGKEQAVNEHICRALDGISVALGETT
INFSCALNGSFDVKTLTVPTTTKKRYSVSMFDEVEVQPIQQQPQKKSVGGRMAIVKFLAR
TLLLMVIETEPNNSLLMQVRNELPENTKADVESACADFFLSLEHLTKVKEHDAWYVMSQY
LLDFQKQNCRTKRIINEGFITLQLRRIFRNAMGSKDVNFIELFTMLVVDSEALALLEKLS
VEVKTDLQKINFLTLSAMYHEHIEDLDSVHMIRTKRLKLFYYLEFCQQDHRIKGKFNADM
DNIEDLLKEFHNKQLDVQLLERMSKDFGFDYQKILITQILSILSAQELRFEVKRDTFGDE
ELVMLSSAQEMRDMCQPYINEINNVELFTSKLKHFIEDINIYFYELYMCVINILMYFDSA
PKEMEIWMNILHFLRHKMITRRRNRPGQVETDTWLKSQRENGVMPKISRYRLPFKPIVEQ
PLKDILDSELNVDNCQSWFPLIQMYTALKGSKDSSQNCDYFCMSAVKNSISEYKSKNDSE
SWSLHPTNNAFLQSILRLVEKVNNPNKAFLILYFVSNYARDGADQVEASYECWKFVKEKG
HLITDPKSREQVAKVKRRYPIQKTQHLLYVYGLTDEKLLRQVENPTELIQALYHHELILK
SSKVDINALVAEIAKLHDLCLATIQYRLLQKWLALTMESAGDGTILEETFMEEQNWPEQA
NGAESSNSQDASENVNRAFYILSSWPKAEAVKFLVGLIFKGGSVNTSTQLQMYECYSKLN
DGSNSFTNTISQRQFISIKCVHELKALGYKSNLEKFSDDHCNKIDILKMIWQRNAQNPLS
LEVMANICLGFDIHLPQIWNGILKRMVMFHMVRELNALLDVLSCRPHLLHLDGLAQAWDY
VLCHPLQNAVELRSFKQEEVLHKTLLRLQGCPVVHALNLLQFAQLCIVVHRPHMAASLLS
FCQSSEQRQKIKKMIHSHPVENLRQQILDLEDAGILPVVLNFALKELNL
Download sequence
Identical sequences Q9V9W7
FBpp0085156 FBpp0085156 NP_476705.1.81976 7227.FBpp0085156 FBpp0085156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]