SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085166 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085166
Domain Number 1 Region: 111-207
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.62e-22
Family Ribosomal protein L14e 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085166   Gene: FBgn0039857   Transcript: FBtr0085805
Sequence length 262
Comment type=protein; loc=3R:complement(27420646..27421323,27421770..27421880); ID=FBpp0085166; name=RpL6-PB; parent=FBgn0039857,FBtr0085805; dbxref=FlyBase:FBpp0085166,FlyBase_Annotation_IDs:CG11522-PB,GB_protein:AAF57167.1,REFSEQ:NP_651876,GB_protein:AAF57167,FlyMine:FBpp0085166,modMine:FBpp0085166; MD5=ba2930e7c501012c8593accfaaa0cb45; length=262; release=r5.30; species=Dmel;
Sequence
MAPIEKAKKVAKSAKKGKKHPVNSYLKGGILRYSKAQMYKRRALYRLKDKKSPVVEKAKV
PIKKVKKIGGPKNGGERTVFLKKSKASYPTKTFVKKRPSKANFSEHKRNTRRNLTPGTVL
ILLAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAFKVPE
HLNDAYFRRLKAKKDKKTGEADIFAAKKERFVPNEQRKKDQKEVDAALLKVIKAHPEGKF
FAKYLQNMFALHSSQYPHRMRF
Download sequence
Identical sequences Q9V9W3
FBpp0085166 FBpp0085166 FBpp0085166 NP_651876.1.81976 7227.FBpp0085166 FR335 FR72

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]