SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085184 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085184
Domain Number 1 Region: 518-614
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.22e-18
Family PWWP domain 0.0027
Further Details:      
 
Domain Number 2 Region: 393-514
Classification Level Classification E-value
Superfamily Bromodomain 0.0000000000432
Family Bromodomain 0.0018
Further Details:      
 
Domain Number 3 Region: 337-391
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000035
Family PHD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085184   Gene: FBgn0039863   Transcript: FBtr0085823
Sequence length 1121
Comment type=protein; loc=3R:join(27496501..27497517,27497636..27497802,27497866..27497947,27499179..27499359,27499428..27501103,27501180..27501422); ID=FBpp0085184; name=CG1815-PB; parent=FBgn0039863,FBtr0085823; dbxref=FlyBase:FBpp0085184,FlyBase_Annotation_IDs:CG1815-PB,GB_protein:AAN14281.1,REFSEQ:NP_733442,GB_protein:AAN14281,FlyMine:FBpp0085184,modMine:FBpp0085184; MD5=c5cc261ee5e3ec92ab1bc707a7bebf8b; length=1121; release=r5.30; species=Dmel;
Sequence
MESTDSSDSSGDSLKSIPRPDFEALSAIGSPQPQLQSSSLDGHVEMEPVIMPSKRQKYIV
SAPPGSANCSSNSSSSSPSNINVGSSLTMKLTKVQPQQHQAKSSTPNNKGKVAKEMVALQ
RSHIESEVLSNFVTGVSKLKSRKSRYVPGNLATQAVGGELSRSLNTSSENENKSLKVALK
RSSSIPAPILDSDDDWQDEDIAWGVTTCRPRGRSMAFEDGERLANLNAEDRNIVPAYSMA
TRCRSRSKTLSLSNSWSNDDKGPRRSNLRSENEEFAKKHNAFLDRIIHDDRESELALNTS
GEGESSLFSDASDTKTTTAKTPEEEAAERLALIYEEPPTPGWDPFCWKCRGCGKLMPCSK
CLRSFHSYCVRPATTKFDSSWKCPECQVIEAAPKRLRRNGVSVDLLSQLLSFALDRMKHV
RGAHKLRSPLEVFPLTYKKFFVNPVSFESLAQCIRNGAYQSTDEFLSEVKWIQHNALILD
AGDAKVEQASKAVVKVCRQEANEIDTCPECYLNANSSDEWFVKVCRHPHLLLWAKLKGFP
YWPAKAMGSSNSTLVNVRFFGKHDRAFVPVKDCFLYSAQNPNTQTSRRSARDLAECIREV
EIHIDHIKRKIGAFNYAPYRTPYDPLEEQQQLEQMMPGVYAAIDRELEPANKTPLQFLIR
KTADDKLSIVKKTKATESGNESDQSPSPTKKLSEVDVVSVTGSGCSDHSNVKSNNYEVIS
RSGESLTDSRCKVLLKRKSLAAKIVAESVETSEAVAPKRKHSLSDASFTSESSEHKRKSK
HARKQHDNQDNQIEEAEKTGQEPPKSPTISKQNENLRDEENVIENAANDTSSASPVSASV
VSVVELVRRRQGVTITKIPREQQQTAEDTAAVPIPLPTAPPPKQNIPKGNEAANPKQSDV
ERQQEQLIKKVIPFIEIKTEVMSEPDDEGIEEASPANQPQTDQVPLQQETITAQPESQMP
AAAPAPQPKPVDNAPFEEVRIKEEILSEDEMETEQSIVSRRLKSVPPMPLPMPPPPPLPP
REESPATADSVRFVGDTTIQRVYPRHPLQLTRPFCQPHLHLRHHQSQLARLLLASHRLRH
RPRESLRHTFNFEEKTIVSQPPHRRLLHQPQTRLLCSDPTW
Download sequence
Identical sequences Q8IMG3
FBpp0085184 FBpp0085184 NP_733442.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]