SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085624 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085624
Domain Number 1 Region: 3-191
Classification Level Classification E-value
Superfamily L domain-like 3.4e-37
Family Internalin LRR domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085624   Gene: FBgn0034485   Transcript: FBtr0086315
Sequence length 378
Comment type=protein; loc=2R:join(16124143..16124473,16124532..16124714,16124794..16124941,16125198..16125509,16125764..16125926); ID=FBpp0085624; name=CG11099-PA; parent=FBgn0034485,FBtr0086315; dbxref=FlyBase:FBpp0085624,FlyBase_Annotation_IDs:CG11099-PA,GB_protein:AAF57504.1,REFSEQ:NP_611457,GB_protein:AAF57504,FlyMine:FBpp0085624,modMine:FBpp0085624; MD5=8f1483ae22fee22f59051a94631af1e0; length=378; release=r5.30; species=Dmel;
Sequence
MNKTILHWSYLNFKDVPMDLFLYEDLEEVYLKENFISVIPKWLLNITTLKFIHLAGNNLS
ELPVDIYMLENLEFLDVSNNELKELPPTLGLLLNLQQLNVSGNQLTELPVELSGLRNLEH
LNIGKNQFRRLPVQLSECVRLNELNVSDNEALVHIPERISNLPMLQSLAADRCALVYLPA
ALSKFMNHVRIFHNTAINYIPMVYERFYQNFYDNRQRNTPVAVHRKGLFWVRELETSTRL
LLPVGTRTVFPVPSVENRVSLYDDCLHALQTLNRFTPVYENVAMHRLLPEPYISSHINNG
PIARCTNSTCSRCLYTSYYFMVVKRRGSTSKQLFTCNFCTNRCGLLWLTSNDKKYYQLAW
RVSDDDDDDEEEHMASNK
Download sequence
Identical sequences Q7JXU8
FBpp0085624 FBpp0085624 NP_001286627.1.81976 NP_611457.1.81976 7227.FBpp0085624 FBpp0085624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]