SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085699 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085699
Domain Number 1 Region: 15-144
Classification Level Classification E-value
Superfamily Bromodomain 1.57e-33
Family Bromodomain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085699   Gene: FBgn0034423   Transcript: FBtr0086511
Sequence length 674
Comment type=protein; loc=2R:join(15147570..15147572,15147627..15149648); ID=FBpp0085699; name=CG7229-PA; parent=FBgn0034423,FBtr0086511; dbxref=FlyBase:FBpp0085699,FlyBase_Annotation_IDs:CG7229-PA,GB_protein:AAF57589.2,REFSEQ:NP_611401,GB_protein:AAF57589,FlyMine:FBpp0085699,modMine:FBpp0085699; MD5=23c492a5c2259742aad65f9c0ad5f1ee; length=674; release=r5.30; species=Dmel;
Sequence
MASCKPLSVKLKLPNRVQPEFIPHPGMAGRYTNKLHYFKKHLLDEARKKKYALDFLEPVD
TEALMVPTYYTVIHRPMDIGTIVKRVQNNYYKSVNEAIADFKQIISNCFLFNRSGDVVYR
KGQMLEKFFHKKLRGMPSGPEVPCNRDPKAVGRPRTNAPSSAQTERKCRELLKKLQSITN
QTDAMTRNFFSNKWDSLQKKVDRQYFKSVNEFCLHVDGCFRKYHEPAKILYERVFNQPAA
WCTSMNGNSSLESALNAADLNELLAAAKLTVNSLMQCVQMPGSGEPLTAKSLVETFCDTL
NKMINKMEAGQRNSPNPSSSKRQKMSPEQETDLVQGEFKPAMELLSGNEIDNLMAVSIES
SDDEAIDASMRITDADRCATQKLFAKLPTNAMKEIIHMVQQIEGFSSENCGDLSFDVKGL
ATDTMIMMKSAVTKATRAHSKLKLKDMQPSEKEGLQRALQSQLVNITRMLNKNRRRCGPL
INFRNKNNTANNVVRKRATAPLTAKLKPLQANVMAPQLGAGVVETHNLSDTSDDDVSAPV
KLSAIGGTPMRNLPINSNPLQMQPIRSPPKLPHVVELQMSSSSSSESEMKSKSGRLSRSR
SRSMSDTKLRPRSNSSASSRSNSSSSSGSNAGSSSGSRSRSSSSSSSSSNNSSESNDSSD
VEVVPNVPEGQLRA
Download sequence
Identical sequences Q4V5A7
NP_611401.2.81976 FBpp0085699 FBpp0085699 FBpp0085699 7227.FBpp0085699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]