SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085727 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085727
Domain Number 1 Region: 457-752
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-77
Family Protein kinases, catalytic subunit 0.0000000437
Further Details:      
 
Domain Number 2 Region: 941-1082
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 4.97e-54
Family FAT domain of focal adhesion kinase 0.0000407
Further Details:      
 
Domain Number 3 Region: 141-260
Classification Level Classification E-value
Superfamily Second domain of FERM 7.18e-34
Family Second domain of FERM 0.00017
Further Details:      
 
Domain Number 4 Region: 263-392
Classification Level Classification E-value
Superfamily PH domain-like 3.57e-25
Family Third domain of FERM 0.0011
Further Details:      
 
Domain Number 5 Region: 20-139
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000878
Family First domain of FERM 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085727   Gene: FBgn0020440   Transcript: FBtr0086543
Sequence length 1200
Comment type=protein; loc=2R:complement(15318611..15319067,15319132..15319242,15319297..15319751,15319808..15319897,15321007..15321146,15321208..15321347,15321409..15321613,15321669..15321813,15321875..15322007,15322065..15322197,15322260..15322755,15322819..15323054,15323113..15323222,15323282..15323984,15324053..15324101); ID=FBpp0085727; name=Fak56D-PB; parent=FBgn0020440,FBtr0086543; dbxref=FlyBase:FBpp0085727,FlyBase_Annotation_IDs:CG10023-PB,GB_protein:AAM70852.1,REFSEQ:NP_725891,GB_protein:AAM70852; MD5=19e815ed52834f904f330652e9b8e2c2; length=1200; release=r5.30; species=Dmel;
Sequence
MNTAGATSQPPPTKNEINSEEYLIHVHMPNKSFKAVRFNVKETVFHVIRRTVEDLGTDGR
TPSIQRYACRMLNMITKEVIWLARSTSMQKVLSHILTPGCSNVDCPNNQSELDEVLLEHG
RRITDNRVWRVELRVRYVPNNIQELFEEDKATCFYYFNQVKEDFIQANVTAIDTEVAVQL
CCLGIRHYFKNITVKAPDKKQHIDYIEKEIGFKSFLPQSVIATSKPKNLKKLIQVGYKKV
YNYNDIEYLTRFFDLLKNIYLTNFEQFSVTLSSAWNISGILHVGPHIGISYQTHPQASLK
NVAQFKDVVSIKTCTLPKEKLSKSGENTTEPELQNFNCNCQKIKTQIKISASNNVEDLVI
TCNGINTAESIADLIDGYCRLLSKDLEFTIWHRETNASNEDSAKALPNDATLGSNKSTSS
QGKPMLTDDYAEIGLLEGEGDYSTPTVRNYELDRALITPSAKIGVGQFGDVYVGTYTLPK
LGKGKNLAGNGKNSNSDQRNADSRPDVIQVAIKTCKANDDPEKTENFLAEAYIMQKFDHP
HIIRLIGICSVMPIWIVMELAKLGELRAYLKTNSERLSHGTLLKYCYQLSTALSYLESKK
FVHRDIAARNVLVSSPTCVKLADFGLSRWVSDQSYYHSTPTVALPIKWMSPESINFRRFT
TASDVWMFGVCIWEILMLGVKPFQGVKNSDVILKLENGERLPLPPNCPPRLYSLMSQCWA
YEPLKRPNFKRIKETLHEILIEDSINSSETLKREQRKVASMSWIGSDDIDIPPSKPSRVM
HDPDITGLMPETTGLPQTYIIAQNPAVLAKLMMENQKRGINPAAYTTPASGIHNVLGEKL
RQQQKDSNSDSEWLIQEELLRQRSCSIPQGSLNDHQAQMFKLDFMSAGPSSLPDCSNSSS
RPMTPNANLSSLKSNHSSADHLSSLTSAEEQMGSNARNLGSAVPSRPPNRADDEVYCATT
LVVKSIMALSQGVEKANTEGYLELVKNVGVKLRNLLTSVDKISIIFPAQALKEVQMAHQV
LSKDMHELVSAMRLAQQYSDTTLDCEYRKSMLSAAHVLAMDAKNLFDVVDSIRQRYQHLF
PPSATKETSCSSSFESTSGSIVAEPVNDLGGYIKTSTSGDLLQNTGIYDNDLHHSFNSQL
QLQNPKASIDLSGGGSLQRGMSLGLDTTRSTNEPLRIVEETLGSPGEHMYCNTSALHGHA
Download sequence
Identical sequences Q0E917
FBpp0085726 FBpp0085727 FBpp0085728 FBpp0291097 FBpp0085726 FBpp0085727 FBpp0085728 FBpp0291097 NP_001137719.2.81976 NP_523793.2.81976 NP_725891.1.81976 NP_725892.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]