SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085742 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085742
Domain Number 1 Region: 22-267
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.29e-65
Family BAR domain 0.00063
Further Details:      
 
Domain Number 2 Region: 304-384
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000105
Family SH3-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085742   Gene: FBgn0034433   Transcript: FBtr0086558
Sequence length 390
Comment type=protein; loc=2R:complement(15195892..15196020,15196078..15196318,15196898..15197088,15197168..15197203,15197321..15197818,15197980..15198057); ID=FBpp0085742; name=endoB-PA; parent=FBgn0034433,FBtr0086558; dbxref=FlyBase:FBpp0085742,FlyBase_Annotation_IDs:CG9834-PA,GB_protein:AAM70847.1,REFSEQ:NP_611410,GB_protein:AAM70847,FlyMine:FBpp0085742,modMine:FBpp0085742; MD5=d6ae314d12ced14025f3a25d4f699d66; length=390; release=r5.30; species=Dmel;
Sequence
MNINLPNFNVKNLVKEAGSTISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEK
IVRDTESVLIPNPQNRVEDFIFEKIEKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQAL
IKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNR
VKKARSMLGQQSKDGISPEAVLEQAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRH
LHAFIQTQVRYYKQCGDVMEQLQRELANLGGPTPYIPLDVNEASASKSNISSGAAARGPG
NNHSANMAATGHKPNQPMHVSTDQMQRARVLCSYDAKDHTELNLSANEVIFVTECSPVNE
DYMYGKQGLLKGLVPRAFVEMLDEEHDVTL
Download sequence
Identical sequences A0A0J9U610 Q8SYD9
NP_611410.1.81976 XP_016028563.1.80810 FBpp0085742 7227.FBpp0085742 FBpp0085742 FBpp0112010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]