SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085743 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085743
Domain Number 1 Region: 22-255
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.34e-65
Family BAR domain 0.00051
Further Details:      
 
Domain Number 2 Region: 292-372
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000979
Family SH3-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085743   Gene: FBgn0034433   Transcript: FBtr0086559
Sequence length 378
Comment type=protein; loc=2R:complement(15195892..15196020,15196078..15196318,15196898..15197088,15197321..15197818,15197980..15198057); ID=FBpp0085743; name=endoB-PB; parent=FBgn0034433,FBtr0086559; dbxref=FlyBase:FBpp0085743,FlyBase_Annotation_IDs:CG9834-PB,GB_protein:AAF57578.2,REFSEQ:NP_725873,GB_protein:AAF57578,FlyMine:FBpp0085743,modMine:FBpp0085743; MD5=739fdfec72310b04abf29efccc5aad6c; length=378; release=r5.30; species=Dmel;
Sequence
MNINLPNFNVKNLVKEAGSTISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEK
IVRDTESVLIPNPQNRVEDFIFEKIEKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQAL
IKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNR
VKKARSMLGQQSAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYY
KQCGDVMEQLQRELANLGGPTPYIPLDVNEASASKSNISSGAAARGPGNNHSANMAATGH
KPNQPMHVSTDQMQRARVLCSYDAKDHTELNLSANEVIFVTECSPVNEDYMYGKQGLLKG
LVPRAFVEMLDEEHDVTL
Download sequence
Identical sequences A0A0J9RGL4 Q8T389
FBpp0085743 NP_725873.1.81976 XP_016028565.1.80810 FBpp0085743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]