SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085929 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085929
Domain Number 1 Region: 4-52
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000214
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0085929
Domain Number - Region: 146-199
Classification Level Classification E-value
Superfamily BLRF2-like 0.0968
Family BLRF2-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085929   Gene: FBgn0034314   Transcript: FBtr0086750
Sequence length 435
Comment type=protein; loc=2R:join(14068227..14068342,14068402..14068617,14068676..14069029,14069090..14069147,14069203..14069322,14069379..14069582,14069645..14069884); ID=FBpp0085929; name=nopo-PA; parent=FBgn0034314,FBtr0086750; dbxref=FlyBase:FBpp0085929,GB_protein:AAF57730.2,FlyBase_Annotation_IDs:CG5140-PA,REFSEQ:NP_611305,GB_protein:AAF57730,FlyMine:FBpp0085929,modMine:FBpp0085929; MD5=966fa10b277e67e02130fdeb01328f41; length=435; release=r5.30; species=Dmel;
Sequence
MLNLNCVICAELFGQADEVFATVCGHMFHHNCLNQWLDRSKTCPQCRNKCTTRNIFRVYF
NLANLDVSHIDVGSLQEQLDNAMLSMKMVEKERNKDEQQIRDLKETQKKCLKTIAGLEQK
VQKKDFLISSYVEQIGVLKSDAHVVDGLRKENKTLKSQIQSMEGISAILAAGSADADRLL
KNEADPHVLANWVSTLKRELRQCESKKTELRNVVKVVQNDLRKEIELKRKLEERVSHLES
DLYQAQEKLQAFENKTAYLDSPNASCGLNSNILALKREERRTTISPTVKENIKRIEESTS
PYLNIKSSSVGLAHLLNTKGNIGLAKSKISPIKGVGGGVSMTSGTIRKTSSDLSEKYSIF
KKPRLLLGSSSSSALTATTGSNFVYNGMGGSEKVDPFAQRAEEEGLSTIRSSTALSRNVN
QRLKAGSLRNFNLGK
Download sequence
Identical sequences Q7K2X1
NP_611305.1.81976 7227.FBpp0085929 FBpp0085929 FBpp0085929 FBpp0085929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]