SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086394 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086394
Domain Number 1 Region: 619-718
Classification Level Classification E-value
Superfamily Cadherin-like 3.92e-16
Family Dystroglycan, N-terminal domain 0.035
Further Details:      
 
Domain Number 2 Region: 388-487
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000518
Family Dystroglycan, N-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086394   Gene: FBgn0034072   Transcript: FBtr0087256
Sequence length 997
Comment type=protein; loc=2R:complement(11970777..11970898,11970955..11971116,11971188..11971388,11971451..11972601,11972669..11972994,11973069..11973125,11973550..11973798,11975810..11975870,11975957..11976040,11976188..11976330,11976412..11976543,11976597..11976791,11977076..11977186); ID=FBpp0086394; name=Dg-PA; parent=FBgn0034072,FBtr0087256; dbxref=FlyBase:FBpp0086394,FlyBase_Annotation_IDs:CG18250-PA,GB_protein:AAF58068.2,REFSEQ:NP_523756,GB_protein:AAF58068,FlyMine:FBpp0086394,modMine:FBpp0086394; MD5=0cb2864a75548a682551a300976e36a7; length=997; release=r5.30; species=Dmel;
Sequence
MRFQWFLSASASLSLFLLLDFVVWIHGERDFNVNDSQVPVIEPKDVPAYKQDPYVTELMS
CQNTPSEIVLSLLLKKHDWSELTATKRAHVQAKLAKFFAIPKEFISLDSVSKRELRSMHK
LAMRKGGKGNKNIETLNRRLGRASFMIGCGPSYFVMGEPIAKQIAHQMKDGTIGALTEEN
FGLWFIWRKELKSRSNRKRRQSEGSGADEDDYDYGDDDEEVAEPSTEVPPVTTHAHRHHH
GAPNTVLNELELSTQLPIDDFEGTATATQPTGTATATAIASTAAAAAATAAAATATATTA
NASATTAGESEFHIESTTHRTISSKEGGEPDAISSGNNSLANNELSTPATPTSSVATTTA
STPESSSISSNFVSTDYMEPQPEENSPPIIKTRLQKLAVTSGKAFTFHVLPETFYDAEDQ
GNLRLALTDKDGHELKANSWLQFNADKRELYGLPLDDTVSRWQYRLSATDSGNASVTETV
EISVQQHRAVRTINHEISVFVRINEKPGHNIDWQLKLINAVARTLDDSTNSAVVVREIRQ
TPHDPHSATFVYFNETLPTSECPEKELKDIIARLDANRLSDLVQPQLGIKSITGQLIGSC
QKDLTQVKPTQHMTKNVPPMPRNQVDRVNASLGQLLVYKVPADTFYDANDNQLTLTLKTR
DHLELSPRHWLQFDSKNEEFYGIPKSGDIGSEEYLLVAEDSGGLSAHDALVVVVSPAPKR
DFGFFFKAYLSIKHERFNADLQRKFVERVAKLNGDPTTGQIQIRSITTHHDSDGTIVNFY
NTTLYRKHNSCREKEVAMTRSVYLNSDLSLREAAKRALGPELNLTNFSVVPFSICHHTEN
IDTNQLDYIPSRPEEPTHKSSFGEDYMITFVWPIVIIVAMLVAASIIACCLHWCRQRSGK
MELGDEEERKSFRAKGIPVIFQDEYEEKPEIGNKSPVILKDEKPPLLPPSYNTSNMNGDN
DVDDYVPPPSVVVGGREVRGKSPATPSYRKPPPYVSP
Download sequence
Identical sequences Q8STB9
FBpp0086394 FBpp0086394 NP_523756.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]