SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086439 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086439
Domain Number 1 Region: 518-659,715-865
Classification Level Classification E-value
Superfamily L domain-like 4.53e-58
Family Ngr ectodomain-like 0.00000031
Further Details:      
 
Domain Number 2 Region: 72-278
Classification Level Classification E-value
Superfamily L domain-like 1.17e-42
Family Ngr ectodomain-like 0.0004
Further Details:      
 
Domain Number 3 Region: 293-500
Classification Level Classification E-value
Superfamily L domain-like 2.72e-41
Family Ngr ectodomain-like 0.00063
Further Details:      
 
Domain Number 4 Region: 1137-1325
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-39
Family Laminin G-like module 0.0033
Further Details:      
 
Domain Number 5 Region: 1064-1110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000359
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 947-990
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000122
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 904-946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000168
Family EGF-type module 0.007
Further Details:      
 
Domain Number 8 Region: 985-1029
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000746
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 1025-1062
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000144
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 1352-1393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000214
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086439   Gene: FBgn0003425   Transcript: FBtr0087304
Sequence length 1469
Comment type=protein; loc=2R:complement(11760884..11760970,11761040..11761182,11761828..11761954,11762017..11763541,11763606..11763749,11764536..11764607,11764677..11765045,11766566..11766637,11766901..11767119,11767204..11767357,11767427..11767584,11768872..11769087,11770074..11770217,11770299..11770440,11771840..11772075,11772850..11772993,11773604..11773675,11773749..11773820,11777795..11778108); ID=FBpp0086439; name=sli-PB; parent=FBgn0003425,FBtr0087304; dbxref=FlyBase:FBpp0086439,FlyBase_Annotation_IDs:CG8355-PB,GB_protein:AAM70966.1,REFSEQ:NP_476729,GB_protein:AAM70966,FlyMine:FBpp0086439,modMine:FBpp0086439; MD5=93a5c72a57a543f6e64adbf09a8797e0; length=1469; release=r5.30; species=Dmel;
Sequence
MAAPSRTTLMPPPFRLQLRLLILPILLLLRHDAVHAEPYSGGFGSSAVSSGGLGSVGIHI
PGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDF
QRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLD
NNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSW
LSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR
CADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISR
IAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSL
SLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCE
SPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSDCPAMCHCEGTTVDCTGRGLKEI
PRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQEL
QLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCH
LAWFAEWLRKKSLNGGAARCGAPSKVRDVQIKDLPHSEFKCSSENSEGCLGDGYCPPSCT
CTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITI
LSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSL
THIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRV
RNDILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNAT
CTVLEEGRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEF
CDTKIQFCSPEFNPCANGAKCMDHFTHYSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCV
DGINDYQCRCPDDYTGKYCEGHNMISMMYPQTSPCQNHECKHGVCFQPNAQGSDYLCRCH
PGYTGKWCEYLTSISFVHNNSFVELEPLRTRPEANVTIVFSSAEQNGILMYDGQDAHLAV
ELFNGRIRVSYDVGNHPVSTMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEG
SNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGNAQRQQK
ITPGCALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARDGYQC
KCKHGQRGRYCDQAASTCRKEQVREYYTENDCRSRQPLKYAKCVGGCGNQCCAAKIVRRR
KVRMVCSNNRKYIKNLDIVRKCGCTKKCY
Download sequence
Identical sequences NP_476729.1.81976 FBpp0303574 FBpp0086439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]