SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086614 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086614
Domain Number 1 Region: 29-137
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.09e-24
Family Hormone receptor domain 0.00076
Further Details:      
 
Domain Number 2 Region: 110-399
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000022
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086614   Gene: FBgn0033932   Transcript: FBtr0087485
Sequence length 504
Comment type=protein; loc=2R:join(10269711..10269975,10270200..10270398,10270515..10270608,10270754..10270928,10270987..10271060,10271128..10271238,10271467..10271655,10271723..10271838,10272087..10272143,10272207..10272414,10272480..10272506); ID=FBpp0086614; name=Dh44-R1-PA; parent=FBgn0033932,FBtr0087485; dbxref=GB_protein:AAF58250.1,FlyBase:FBpp0086614,FlyBase_Annotation_IDs:CG8422-PA,REFSEQ:NP_610960,GB_protein:AAF58250,FlyMine:FBpp0086614,modMine:FBpp0086614; MD5=276b5d2ada2bcd3443e7e59bdb9016e2; length=504; release=r5.30; species=Dmel;
Sequence
MSDHNHIDSVNASGSDPLLDLHNLDGIGESVELQCLVQEHIEASTYGNDSGHCLTQFDSI
LCWPRTARGTLAVLQCMDELQGIHYDSSKNATRFCHANGTWEKYTNYDACAHLPAPESVP
EFEVIVELPTIIYYIGYTLSLVSLSLALIVFAYFKELRCLRNTIHANLFFTYIMSALFWI
LLLSVQISIRSGVGSCIALITLFHFFTLTNFFWMLVEGLYLYMLVVKTFSGDNLRFNIYA
SIGWGGPALFVVTWAVAKSLTVTYSTPEKYEINCPWMQETHVDWIYQGPVCAVLIINLTF
LLRIMWVLITKLRSANTVETRQYRKAAKALLVLIPLFGITYLVVLAGPSESGLMGHMFAV
LRAVLLSTQGFSVSLFYCFLNSEVRNALRHHISTWRDTRTIQLNQNRRYTTKSFSKGGGS
PRAESMRPLTSYYGRGKRESCVSSATTTTLVGQHAPLSLHRGSNNALHTMPTLAANAMSS
GSTLSVMPRAISPLMRQGLEENSV
Download sequence
Identical sequences A1Z9Q8 B4QFH2
FBpp0086614 FBpp0086614 FBpp0086614 NP_610960.1.81976 XP_016027604.1.80810 XP_016027605.1.80810 7227.FBpp0086614 FBpp0209452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]