SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086801 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086801
Domain Number 1 Region: 26-346
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 8.24e-85
Family NAD kinase-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086801   Gene: FBgn0053156   Transcript: FBtr0087681
Sequence length 375
Comment type=protein; loc=2R:complement(9436112..9436399,9436459..9437041,9437104..9437360); ID=FBpp0086801; name=CG33156-PC; parent=FBgn0053156,FBtr0087681; dbxref=FlyBase:FBpp0086801,FlyBase_Annotation_IDs:CG33156-PC,GB_protein:AAF58357.1,REFSEQ:NP_788348,GB_protein:AAF58357,FlyMine:FBpp0086801,modMine:FBpp0086801; MD5=c959774912543bfca9e9cd6e145e5412; length=375; release=r5.30; species=Dmel;
Sequence
MKNSAMVMQIQDPASQRLTWYKPPLTVLVIKKVSDASVLAPFVYLVDWLLQEKNMVVWVE
SAVLEDVQLNENVRFKAIRDKLVTFKDGRDDLTDRIDFIVCLGGDGTLLYASLLFQQSVP
PVMAFHLGSLGFLTPFRFDNFEEQLTSVLEGHAALTLRSRLRCVMHRRSDRKHEAKTLEA
DLDGEARPAANSILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSTPTGSTAY
AAAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPESRNTSWVSFDGRNR
QELFHGDSLRVTTSIYPVPCICAQDQISDWFASLADGLHWNVRKRQKCLDELSDLTASGS
EDTLDEIENMKLYDV
Download sequence
Identical sequences Q8IGA7
NP_788348.1.81976 FBpp0086801 FBpp0086801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]