SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086868 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086868
Domain Number 1 Region: 64-150
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.22e-22
Family Hormone receptor domain 0.0016
Further Details:      
 
Domain Number 2 Region: 115-426
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000915
Family Rhodopsin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086868   Gene: FBgn0052843   Transcript: FBtr0087755
Sequence length 443
Comment type=protein; loc=2R:complement(9156554..9156598,9156897..9157025,9160158..9160281,9160590..9160766,9161045..9161271,9161358..9161484,9162630..9162721,9162795..9162901,9164949..9165086,9165480..9165645); ID=FBpp0086868; name=Dh31-R1-PA; parent=FBgn0052843,FBtr0087755; dbxref=FlyBase:FBpp0086868,FlyBase_Annotation_IDs:CG32843-PA,GB_protein:AAN16138.1,REFSEQ:NP_725278,GB_protein:AAN16138,FlyMine:FBpp0086868,modMine:FBpp0086868; MD5=4882b439c65af09426be423636d671bb; length=443; release=r5.30; species=Dmel;
Sequence
MSDQIGNPNATFSGSGSGSGTNVASIAESVAESGPDFDALRAACETRLNASGQLAGSGGP
GAEAGTHCAGTFDGWLCWPDTAVGTSAYELCPDFITGFDPARYAHKECGLDGEWFKHPLT
NKTWSNYTTCVNLEDLNWRHTVNLISEVGYGTSLLAILLSLAILGYFKSLKCARITLHMN
LFASFAANNSLWLVWYLLVMPNSELLHQSPMRCVALHITLHYFLLSNYSWMLCEGFYLHT
VLVAAFISEKRLVKWLIAFGWGSPAIVIFVYSMARGLGGTPEDNRHCWMNQTNYQNILMV
PVCISMFLNLLFLCNIVRVVLLKLNAPASIQGSCGPSRTVLQAFRATLLLVPLLGLQYIL
TPFRPAPKHPWENTYEIISAFTASFQGLCVAILFCFCNGEVIAQMKRKWRMMCFSNRPRT
NSYTATQVSFVRCGPPLPGEEKV
Download sequence
Identical sequences A1Z9B7
NP_725278.1.81976 FBpp0086868 FBpp0086868 FBpp0086868 7227.FBpp0086868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]