SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087047 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087047
Domain Number 1 Region: 45-169
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.66e-25
Family Hormone receptor domain 0.00066
Further Details:      
 
Domain Number 2 Region: 128-447
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000265
Family Rhodopsin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087047   Gene: FBgn0033744   Transcript: FBtr0087936
Sequence length 475
Comment type=protein; loc=2R:join(8368439..8368678,8372044..8372161,8372214..8372415,8372471..8372567,8372622..8372715,8372774..8372934,8372996..8373106,8373173..8373358,8373419..8373543,8373765..8373815,8374091..8374133); ID=FBpp0087047; name=CG12370-PA; parent=FBgn0033744,FBtr0087936; dbxref=FlyBase:FBpp0087047,FlyBase_Annotation_IDs:CG12370-PA,GB_protein:AAF58501.3,REFSEQ:NP_725175,GB_protein:AAF58501,FlyMine:FBpp0087047,modMine:FBpp0087047; MD5=ece2d0c71b63971cec666c275abd9aad; length=475; release=r5.30; species=Dmel;
Sequence
MADDDLRALVDSLDDASQEDLAKVIANFSVDMLQRASALIGAQQGSSGGQLQNRTLQCQQ
QQQREEEQASLEALASGGKRILQCPSSFDSVLCWPRTNAGSLAVLPCFEEFKGVHYDTTD
NATRFCFPNGTWDHYSDYDRCHQNSGSIPVVPDFSPNVELPAIIYAGGYFLSFATLVVAL
IIFLSFKDLRCLRNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLVIMFQYFY
LTNFFWMFVEGLYLYTLVVQTFSSDNISFIIYALIGWGCPAVCILVWSIAKAFAPHLENE
HFNGLEIDCAWMRESHIDWIFKVPASLALLVNLVFLIRIMWVLITKLRSAHTLETRQYYK
ASKALLVLIPLFGITYLLVLTGPEQGISRNLFEAIRAFLISTQGFFVALFYCFLNSEVRQ
TLRHGFTRWRESRNIHRNSSIKNRRHRASKDYSLRSRTESLRLTSTSPIPTGHYE
Download sequence
Identical sequences Q4V3E9
FBpp0087047 NP_725175.3.81976 FBpp0087047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]