SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087879 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087879
Domain Number 1 Region: 105-155
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000000327
Family Hairy Orange domain 0.0024
Further Details:      
 
Domain Number 2 Region: 41-109
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000353
Family HLH, helix-loop-helix DNA-binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087879   Gene: FBgn0010109   Transcript: FBtr0088803
Sequence length 435
Comment type=protein; loc=2R:complement(4116922..4118007,4119104..4119199,4119428..4119553); ID=FBpp0087879; name=dpn-PA; parent=FBgn0010109,FBtr0088803; dbxref=FlyBase:FBpp0087879,FlyBase_Annotation_IDs:CG8704-PA,GB_protein:AAF59113.1,REFSEQ:NP_476923,GB_protein:AAF59113,FlyMine:FBpp0087879,modMine:FBpp0087879; MD5=e7784a72ae8965a4e02e3e71ef94d346; length=435; release=r5.30; species=Dmel;
Sequence
MDYKNDINSDDDFDCSNGYSDSYGSNGRMSNPNGLSKAELRKTNKPIMEKRRRARINHCL
NELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQLNMAIQSDPSVVQKFKTGF
VECAEEVNRYVSQMDGIDTGVRQRLSAHLNQCANSLEQIGSMSNFSNGYRGGLFPATAVT
AAPTPLFPSLPQDLNNNSRTESSAPAIQMGGLQLIPSRLPSGEFALIMPNTGSAAPPPGP
FAWPGSAAGVAAGTASAALASIANPTHLNDYTQSFRMSAFSKPVNTSVPANLPENLIHTL
PGQTQLPVKNSTSPPLSPISSISSHCEESRAASPTVDVMSKHSFAGVFSTPPPTSAETSF
NTSGSLNLSAGSHDSSGCSRPLAHLQQQQVSSTSGIAKRDREAEAESSDCSLDEPSSKKF
LAGAIEKSSSAWRPW
Download sequence
Identical sequences Q26263
FBpp0087879 FBpp0087879 NP_476923.1.81976 7227.FBpp0087879 FBpp0087879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]