SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087945 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087945
Domain Number 1 Region: 165-216
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000144
Family Hairy Orange domain 0.00038
Further Details:      
 
Domain Number 2 Region: 101-157
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000589
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087945   Gene: FBgn0027788   Transcript: FBtr0088869
Sequence length 425
Comment type=protein; loc=2R:complement(3883166..3883968,3884710..3884924,3885338..3885597); ID=FBpp0087945; name=Hey-PA; parent=FBgn0027788,FBtr0088869; dbxref=FlyBase:FBpp0087945,FlyBase_Annotation_IDs:CG11194-PA,GB_protein:AAF59152.2,REFSEQ:NP_523657,GB_protein:AAF59152,FlyMine:FBpp0087945,modMine:FBpp0087945; MD5=b5ab6dcad1a4388cd660e0fa24d276c2; length=425; release=r5.30; species=Dmel;
Sequence
MDHNMHVNAPSLHHWGYAAGPGVVMPGATATTPQSHWVPPPQSHHSAHSNHSHGHSQGHS
HGIGSLKRTLSESDCDDLYSEESSKEQISPSEPGSCQLMSRKKRRGVIEKKRRDRINSSL
TELKRLVPSAYEKQGSAKLEKAEILQLTVEHLKSLQSKTLDSLSYDPQRVAMDYHIIGFR
ECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQQRELSAKSCASPGGWSPAAPSSSGY
QPNCAAAPYQSYAAPANPGAYVSSYPTLSASPSQQAQQLGGRTSVSRTSGSAVTESLPSH
DLHSDSSSQQQQQQQQQQQQQQQHQQQQHQQQQQRTQTTPQPTQQQHYTHDHSAVHSEQQ
VPTYIELTNSNRPAAIGSDSLSYSAAPQYPVSGLPGQDYNNSSVLQYATPNGAKPYRPWG
AEMAY
Download sequence
Identical sequences Q7KM13
FBpp0087945 NP_523657.1.81976 7227.FBpp0087945 FBpp0087945 FBpp0087945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]