SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088693 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088693
Domain Number 1 Region: 36-250
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-68
Family SPRY domain 0.00000000104
Further Details:      
 
Domain Number 2 Region: 239-279
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000863
Family SOCS box-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088693   Gene: FBgn0026238   Transcript: FBtr0089752
Sequence length 281
Comment type=protein; loc=2R:complement(1005168..1005307,1008268..1008973); ID=FBpp0088693; name=gus-PF; parent=FBgn0026238,FBtr0089752; dbxref=FlyBase:FBpp0088693,GB_protein:AAF57347.2,FlyBase_Annotation_IDs:CG2944-PF,REFSEQ:NP_724402,GB_protein:AAF57347,FlyMine:FBpp0088693,modMine:FBpp0088693; MD5=e560c358c99e44d43a3384825d719a1e; length=281; release=r5.30; species=Dmel;
Sequence
MNMGQKISGGVKTVSRNDSQSTFKPIIPRELQADFVKPARIDILLDMPPASRDLQLKHSW
NSEDRSLNIFVKEDDKLTFHRHPVAQSTDCIRGKVGLTKGLHIWEIYWPTRQRGTHAVVG
VCTADAPLHSVGYQSLVGSTEQSWGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFLVPDK
FLVALDMDEGTLSFIVDQQYLGIAFRGLRGKKLYPIVSAVWGHCEITMRYIGGLDPEPLP
LMDLCRRTIRQKIGRTNLEEHIQQLQLPLSMKTYLLYKNRR
Download sequence
Identical sequences FBpp0088693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]