SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0089131 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0089131
Domain Number 1 Region: 86-167
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000576
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 
Weak hits

Sequence:  FBpp0089131
Domain Number - Region: 28-93
Classification Level Classification E-value
Superfamily EF-hand 0.000684
Family Calmodulin-like 0.048
Further Details:      
 
Domain Number - Region: 323-429
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00536
Family DNA repair protein MutS, domain III 0.048
Further Details:      
 
Domain Number - Region: 83-327
Classification Level Classification E-value
Superfamily TPR-like 0.0307
Family HAT/Suf repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0089131   Gene: FBgn0045073   Transcript: FBtr0074160
Sequence length 454
Comment type=protein; loc=X:complement(15829284..15829375,15829450..15830041,15830109..15830281,15830352..15830467,15830832..15831064,15831624..15831782); ID=FBpp0089131; name=Stim-PB; parent=FBgn0045073,FBtr0074160; dbxref=FlyBase:FBpp0089131,FlyBase_Annotation_IDs:CG9126-PB,GB_protein:AAS65372.1,REFSEQ:NP_996471,GB_protein:AAS65372,FlyMine:FBpp0089131,modMine:FBpp0089131; MD5=0be1a959d00bd15ae955aaa83c91372e; length=454; release=r5.30; species=Dmel;
Sequence
MGSGSADGACAADDFDCYSGSVQDRFGMEAIASLHRQLDDDDNGNIDLSESDDFLREELK
YDSGYEKRQKAFHFNDDMHISVKELWEAWLRSEVHNWTIEQTTDWLAQSVQLPQYVDLFK
LHKVTGAALPRLAVNNLQYVGNVLGIKDPIHKQKISLKAMDVVLFGPPRETGTRWKDYIL
VTLLLSAIIGCWYAYQQNKNAKRHLRRMAQDMEGLQRAEQSLQEMQKELERARMEQENVA
TEKLDLERRLKEAPTLSSSNSDLEVQQLKKEIEMLRNELSRAEFELVDNCWSPPPQLQSW
LQYTYELESKNHQKKRTSAEKQLQSAREACEKLRKKRSSLVGAFVSTHGKSIDDVDRSIV
EARNALGDVTNELQERLHRWKQIETCLGLNIVNNNGLPYLENVLYGRNGGLQSSMGMSST
KGSRARITNSTEDLDDESIQGKLNFENFSLLATE
Download sequence
Identical sequences XP_016039542.1.80810 FBpp0089131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]