SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0099662 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0099662
Domain Number 1 Region: 437-521
Classification Level Classification E-value
Superfamily Homeodomain-like 7.77e-22
Family SWIRM domain 0.00017
Further Details:      
 
Domain Number 2 Region: 80-133
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000848
Family ZZ domain 0.024
Further Details:      
 
Domain Number 3 Region: 136-187
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000202
Family Homeodomain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0099662   Gene: FBgn0053520   Transcript: FBtr0100273
Sequence length 527
Comment type=protein; loc=3R:complement(14079276..14079514,14079575..14080038,14080097..14080913,14081039..14081102); ID=FBpp0099662; name=Rpb4-PC; parent=FBgn0053520,FBtr0100273; dbxref=FlyBase_Annotation_IDs:CG33520-PC,FlyBase:FBpp0099662,GB_protein:AAX52962.1,REFSEQ:NP_001014637,GB_protein:AAX52962,FlyMine:FBpp0099662,modMine:FBpp0099662; MD5=1640bfe5d99bfa6a2cd1368315d94c04; length=527; release=r5.30; species=Dmel;
Sequence
MSFMNPVDMVDEDAADLQFPKVEPLGPQVKRFIHAHQNEHTRNSMVLYNPHTLHRYLEEM
EEKTRDQNSSVPSATKDANRCATCRCSLTEPYIKCSECLDTLLCLQCFSRGKEAFSHRNN
HAYIIVRDNIQVFADEPHWTARDERILLKTLRTHGYGNWEAVSQALDQRHEPAEVRRHYH
DCYFGGIFERLLNLKHARDSYVPERMPYVFKMRSLDPPRHDDIASMQFRLSAGYRCARGD
FDTPYDTSAESLLSIMVDHRGRDDDNEASESEFEREVTEELQLGLVRAYNNRLRERQRRY
KIMRQHGLIMPNRTVSWISKYVHAFGSDASCMRFLGFMQICPDPIKFDMLLESLRYYREL
HSQLHKLYDLREHGVRTLSGAKLYARLSKERQQAQRDYSRLKQTDAFDWQQLVQHYESNR
SGDPGPLAINSKLYVMNTRRKASPIEIGDLPGYSKLDDGERKLCSVARLVPQSYLDYKNQ
LVTEQAKLGYLRLADARRLIKIDVNKTRQIYDFLLEHGHISRPPSYG
Download sequence
Identical sequences E1JIP2
NP_001014637.1.81976 NP_001163645.1.81976 FBpp0302533 FBpp0302535 FBpp0099662 FBpp0290771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]