SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0099946 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0099946
Domain Number 1 Region: 275-541
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-79
Family Protein kinases, catalytic subunit 0.0000000491
Further Details:      
 
Domain Number 2 Region: 158-304
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-35
Family SH2 domain 0.0000418
Further Details:      
 
Domain Number 3 Region: 98-207
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-22
Family SH3-domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0099946   Gene: FBgn0003501   Transcript: FBtr0100505
Sequence length 552
Comment type=protein; loc=3L:complement(4594641..4595255,4595317..4595624,4595692..4595945,4596064..4596280,4598154..4598418); ID=FBpp0099946; name=Src64B-PD; parent=FBgn0003501,FBtr0100505; dbxref=FlyBase_Annotation_IDs:CG7524-PD,FlyBase:FBpp0099946,GB_protein:AAX52735.1,REFSEQ:NP_001014561,GB_protein:AAX52735; MD5=049496686b57d973252fee663fe6d052; length=552; release=r5.30; species=Dmel;
Sequence
MGNKCCSKRQDQELALAYPTGGYKKSDYTFGQTHINSSGGGNMGGVLGQKHNNGGSLDSR
YTPDPNHRGPLKIGGKGGVDIIRPRTTPTGVPGVVLKRVVVALYDYKSRDESDLSFMKGD
RMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLAEE
NPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYYIATNQTFPSLQAL
VMAYSKNALGLCHILSRPCPKPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEVFY
GKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQEEPIYIVQEYMS
KGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKI
CDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVP
YPGMHSREVIENIERGFRMPKPTNHYFPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFS
VTSEVPYREVQD
Download sequence
Identical sequences B3NC61 B4HU86 B4QR05 M9MSK3 P00528
FBpp0073177 FBpp0073177 FBpp0099944 FBpp0099946 FBpp0099947 FBpp0099948 FBpp0291749 FBpp0291750 FBpp0073177 FBpp0099944 FBpp0099946 FBpp0099947 FBpp0099948 FBpp0291749 FBpp0291750 FBpp0293526 FBpp0293527 DS10_00007154 NP_001014561.1.81976 NP_001014562.1.81976 NP_001014563.1.81976 NP_001014564.1.81976 NP_001189051.1.81976 NP_001246628.1.81976 NP_001246629.1.81976 NP_524934.2.81976 XP_001971923.1.56816 XP_002035371.1.34323 XP_016030457.1.80810 XP_016030458.1.80810 XP_016030459.1.80810 XP_016924766.1.48971 XP_016924767.1.48971 XP_016965931.1.21709 7227.FBpp0099948 FBpp0132718 FBpp0211647 FBpp0195440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]