SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0100126 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0100126
Domain Number 1 Region: 228-261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 2 Region: 12-87
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000864
Family Spermadhesin, CUB domain 0.0077
Further Details:      
 
Domain Number 3 Region: 100-173
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000523
Family Spermadhesin, CUB domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0100126   Gene: FBgn0035880   Transcript: FBtr0100664
Sequence length 754
Comment type=protein; loc=3L:complement(8345629..8346512,8346579..8347283,8347342..8347710,8348244..8348550); ID=FBpp0100126; name=CG17352-PD; parent=FBgn0035880,FBtr0100664; dbxref=FlyBase_Annotation_IDs:CG17352-PD,FlyBase:FBpp0100126,GB_protein:ABC66159.1,REFSEQ:NP_001033995,GB_protein:ABC66159,FlyMine:FBpp0100126,modMine:FBpp0100126; MD5=09144c0e79affb35d15c4928b60d10b5; length=754; release=r5.30; species=Dmel;
Sequence
MAYPRDYGIEHILTCEADNCQVRLDFTDFQLGLTSTLEIFDSNGQMLDSYTGEHFRPPIT
VSSGKSLLLQFRGNSATGVGFRAEVSFVSSKQLKDERLVPYTDCGGMVTGPGGAITMMNM
IENATDVRLFDCIWIIKPGNNYMMMKTHISLRVDDFYGMAARSELTIRQGTTSDAVEIEN
VMWPNNGLSKESHVAPILNGYYIRLRGVFGMSSKLAIVYSVFNYLNCYIGSEFLCGNNHC
ISIRLHCDGFDHCGDGSDEPDSCEEDWAHLHHDRRWYSHKPNYYFPKIDQYPDLKTATGI
FIISTLGIFGVLSGWMVILYRMGVRARHQRELQSHLQTISELLDRQDEDRTPDEPPSYEA
PPDYEEVIKVGMQQELREPRRQRRARRAPPRDRSCSRAASNCTVQSVLPLHRSCTLERDQ
EQPSTSAAAMTHAVAATDTTEDAEHVQTMAQRMLLATAICGTAGTSLPAAKESGQRVQSV
GISTSPSSLSAGGELPTAGGSATTPGSTADECTQGGDSLSISLTLGLPSTTAESPVTTDQ
NQLQKQSPEQTISNCTEHTFLKRSWLVVQQVPPGRGYRVRRLRHTFSSPEAFTSDELHLP
YPDFLSYGTNLPHERSSSNFGSELSRDPSSYSVGKRARLTPEDTSGSETITQEMEQSNQT
LQSHVIVESHPNHSESESEAEQQVSCFGAVAQRPKRRHRGHVRSRSFSNARGGSAGRRRL
MQRSSSADLLMNYATMAVSTPQKTSEAMQRLFFI
Download sequence
Identical sequences Q86P86
FBpp0100126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]