SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0110307 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110307
Domain Number 1 Region: 1044-1251
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-26
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 2 Region: 1265-1432
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.8e-16
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 3 Region: 1525-1548,1617-1772
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000113
Family Laminin G-like module 0.042
Further Details:      
 
Domain Number 4 Region: 90-253
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000274
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 5 Region: 728-770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000147
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 6 Region: 843-885
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000155
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 1875-1912
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000456
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 8 Region: 425-462
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000693
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 9 Region: 1836-1879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000694
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 10 Region: 766-808
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 11 Region: 945-988
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000134
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 12 Region: 1993-2037
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000162
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 13 Region: 804-847
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000365
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 14 Region: 386-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000513
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 15 Region: 349-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000309
Family EGF-type module 0.025
Further Details:      
 
Domain Number 16 Region: 651-698
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000645
Family EGF-type module 0.011
Further Details:      
 
Domain Number 17 Region: 465-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000111
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 18 Region: 305-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 19 Region: 689-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 20 Region: 1916-1960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000172
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 21 Region: 267-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000456
Family EGF-type module 0.024
Further Details:      
 
Domain Number 22 Region: 1803-1842
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family EGF-type module 0.013
Further Details:      
 
Domain Number 23 Region: 1956-1997
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000155
Family EGF-type module 0.016
Further Details:      
 
Domain Number 24 Region: 2032-2070
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000803
Family EGF-type module 0.013
Further Details:      
 
Domain Number 25 Region: 2072-2114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000148
Family EGF-type module 0.01
Further Details:      
 
Domain Number 26 Region: 983-1023
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000274
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 27 Region: 1526-1584
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000675
Family Growth factor receptor domain 0.0084
Further Details:      
 
Weak hits

Sequence:  FBpp0110307
Domain Number - Region: 592-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000163
Family EGF-type module 0.0085
Further Details:      
 
Domain Number - Region: 925-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000877
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 881-901
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0146
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110307   Gene: FBgn0259685   Transcript: FBtr0111008
Sequence length 2189
Comment type=protein; loc=3R:join(20121349..20121586,20130923..20131267,20131613..20132605,20132735..20132863,20133918..20134450,20134747..20135291,20135352..20135457,20135523..20135717,20135783..20136554,20136620..20136802,20136870..20138630,20138699..20138823,20138885..20139298,20139371..20139601); ID=FBpp0110307; name=crb-PB; parent=FBgn0259685,FBtr0111008; dbxref=FlyBase:FBpp0110307,FlyBase_Annotation_IDs:CG6383-PB,REFSEQ:NP_001036751,GB_protein:ABI31202,FlyMine:FBpp0110307,modMine:FBpp0110307; MD5=fc46f98d0386e353a641a2af19c3cc01; length=2189; release=r5.30; species=Dmel;
Sequence
MAKIANASLSQQQKQRQAETATTTTTTVAASVETATTTARSRDRTKSAAQITSHLLKRAI
SVYSSPQWIPLFILIYLATDVASVAVPTKEAYFNGSTYLRLTTPMPIWDHSAISFRSCRG
GEILAQQYNKNSIVISVLNDFLQISLAGPAVHGPNNRLDVKLPYQLLDNRWHTLQFKYEY
GNLYLHVDRAASIFANSTYNSQFLTNQDIGYKDAILILGNSFSGCLLDGPGLQFVNNSTV
QNVVFGHCPLTPGPCSDHDLFTRLPDNFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNC
QKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGA
CVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGA
FCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDK
PIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSASDMEPLTPLELDIL
DATLCPSEKKKRYISPEWLKRKRCELKLSYNCQTSTGDGASALALTPINCNATNGKCLNG
GTCSMNGTHCYCAVGYSGDRCEKAENCSPLNCQEPMVCVQNQCLCPENKVCNQCATQPCQ
NGGECVDLPNGDYECKCTRGWTGRTCGNDVDECTLHPKICGNGICKNEKGSYKCYCTPGF
TGVHCDSDVDECLSFPCLNGATCHNKINAYECVCQPGYEGENCEVDIDECGSNPCSNGST
CIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENC
ELNIDECLSNPCTNGAKCLDRVKDYFCDCHNGYKGKNCEQDINECESNPCQYNGNCLERS
NITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNC
NDGIGTYTCECEPGFEGTHCEINIDECDRYNPCQRGTCYDQIDDYDCDCDANYGGKNCSV
LLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEKTTTLSMVATSLISVTTE
REEGYDINLQFRTTLPNGVLAFGTTGEKNEPVSYILELINGRLNLHSSLLNKWEGVFIGS
KLNDSNWHKVFVAINTSHLVLSANDEQAIFPVGSYETANNSQPSFPRTYLGGTIPNLKSY
LRHLTHQPSAFVGCMQDIMVNGKWIFPDEQDANISYTKLENVQSGCPRTEQCKPNPCHSN
GECTDLWHTFACHCPRPFFGHTCQHNMTAATFGHENTTHSAVIVETTDVARRAIRSILDI
SMFIRTREPTGQVFYLGTDPRKAPTKNIGDSYVAAKLHGGELLVKMQFSGTPEAYTVGGQ
KLDNGYNHLIEVVRNQTLVQVKLNGTEYFRKTLSTTGLLDAQVLYLGGPAPTRESLLGAT
TEPGIIPVPGAGIPIEDTTVPKEADDSRDYFKGIIQDVKVSNGSLNLIVEMYSLNVTDVQ
VNAKPLGAVTIDRASVLPGEVSDDLCRKNPCLHNAECRNTWNDYTCKCPNGYKGKNCQEI
EFCQHVTCPGQSLCQNLDDGYECVTNTTFTGQERSPLAFFYFQEQQSDDIVSEASPKQTL
KPVIDIAFRTRAGGTLLYIDNVDGFFEIGVNGGRVTITWKLSALHFGESARFEKENTDGE
WSRIYLRAHNSKLEGGWKGWESMVDPTPAFSTDIDQAAFQSLIATSTQVYLGGMPESRQA
RGSTLSAQQGSQFKGCVGEARVGDLLLPYFSMAELYSRTNVSVQQKAQFRLNATRPEEGC
ILCFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFF
CQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCEN
EPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIPFCEITPCDNGGLCLTTGAVPMCK
CSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEG
DYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCE
CPEGFAGKNCTAPITAKEDGPSTTDIAIIVIPVVVVLLLIAGALLGTFLVMARNKRATRG
TYSPSAQEYCNPRLEMDNVLKPPPEERLI
Download sequence
Identical sequences FBpp0110307 NP_001036751.1.81976 7227.FBpp0110307 FBpp0110307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]