SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111502 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111502
Domain Number 1 Region: 498-732
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.94e-20
Family FCH domain 0.035
Further Details:      
 
Domain Number 2 Region: 911-968
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000127
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111502   Gene: FBgn0085394   Transcript: FBtr0112590
Sequence length 1030
Comment type=protein; loc=2R:join(11303022..11304336,11306856..11307056,11308181..11308289,11308356..11308461,11309032..11309148,11309447..11309692,11310222..11310401,11310475..11310600,11311764..11311910,11340362..11340513,11343940..11344064,11344165..11344320,11350803..11350915); ID=FBpp0111502; name=CG34365-PF; parent=FBgn0085394,FBtr0112590; dbxref=FlyBase:FBpp0111502,FlyBase_Annotation_IDs:CG34365-PF,REFSEQ:NP_001097325,GB_protein:ABV53808,FlyMine:FBpp0111502,modMine:FBpp0111502; MD5=44218a0726621ae94e109f84e49beb61; length=1030; release=r5.30; species=Dmel;
Sequence
MYVIYPADELILMTYGFFAPRVKPRPSLDCLPEPLVPIEYPARATNTSNLAGHHTNKVPT
NAAVHFEAITPPIAIQPATAPAALASFYPGSPPASPPFTYPGSPVPSNFFDFEEVVPPPT
FQCQSQSLPPTPTRRTSRASLTHSNNSNLSHQGSTKRSSLRRNPQRPPTASMYNDYNDAS
QMQGNSATGPGRAPFQRSSAAIDQDSAAGGALEHYGDLRSRSPSIFLEPPTPDPTHAHFG
PGWGRPMSPMDLPPERSSASASGSKSPTGKSRLRPKLHLPLGRLGRSSSSDTRESNRLRE
DVHVHVENPVFSSENLRQNNFDAFFEAREPVIKLHPKTPNTAPADGSGRGYSPPLENYAG
VYDSPRTRSPAGKSGASGGGLFARSPREDRERMAGARSRSADQCDGAVGGQASGAAARGS
NSAGGGGGGASSGGTPSKGSSVKSSSGRRSRRRRIFGWRGPRGGSLSPQGGSMASYNGVL
KDYSHSSLNEAFKSQNNVNFKLIKTVSDFSETLSRLYEEHATALQVAVSNYRKKNAELRK
ERPACHLAIFQAWETFLQEVETDSQACNDVASVLSRQVSRPMLDKSFHRKVQSRKIFTHR
ESFETIIAKTEEKLSKCRVDYKQCHLAHRQNPSQHSLTEYIDAHNAYVQQLHATNGMLEA
YHTDTLPQQMQELEEIHNDLVAIVSDSLMQGAEVIAGKANDQAKRYNSLSNQCAAVSPQQ
DLVNFVRLLAQPSQAQKIPRRLFASPQAEVGEEAGDHNEMTPCLRNELVFDRHSTLSQRS
ALESLKREAIELELQIRQLQDSIEALNRTQTRGIEGQLYNKVNELQEDLSMKKFDLRAKQ
IHLAAIRAQKDLFVSKVEPTSPRNERKFSAATAPSMKTKWLKAFKSLKPAGSGSAQQADR
RNGASSTASEPLRPNLDGSHHLQEYTYKKITACDVCSQILRGHTRQGLRCRICKLNAHGD
CAPNLPRCQPKQKLLRRQKSTSELENRVDIEEETSANPKSETTRPFGEPLMLLKSTESNP
DESKGNRRVR
Download sequence
Identical sequences FBpp0111502 7227.FBpp0111502 FBpp0303043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]