SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111512 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111512
Domain Number 1 Region: 401-685
Classification Level Classification E-value
Superfamily ARM repeat 8.32e-24
Family Armadillo repeat 0.0098
Further Details:      
 
Domain Number 2 Region: 680-757
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.96e-16
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 
Domain Number 3 Region: 829-972
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000000000000536
Family Toll/Interleukin receptor TIR domain 0.007
Further Details:      
 
Domain Number 4 Region: 761-823
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000165
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111512   Gene: FBgn0085402   Transcript: FBtr0112600
Sequence length 1360
Comment type=protein; loc=3L:join(8091569..8091825,8092246..8092636,8095993..8097918,8097980..8098159,8098227..8098396,8098540..8098757,8099116..8100049,8101386..8101392); ID=FBpp0111512; name=Ect4-PF; parent=FBgn0085402,FBtr0112600; dbxref=FlyBase:FBpp0111512,FlyBase:FBpp0110190,FlyBase_Annotation_IDs:CG34373-PF,FlyBase_Annotation_IDs:CG7915-PC,REFSEQ:NP_001036594,GB_protein:ABI31243,FlyMine:FBpp0111512,modMine:FBpp0111512; MD5=28b51a6e9d0b183c4a506b5ab05cfb90; length=1360; release=r5.30; species=Dmel;
Sequence
MKAAEIKRDLTNIQKSMSEINDLAKERITGGPGSISTTSASAITAPSTMSQTTTSRLAPK
LTSAHPSIDDLRGLSRQDKITQLQKKIRASFENLVDHDDSNVIVTLPDDDDCPHNHFGSG
LNLTHPTAAQLSASGLSGSSKTIDTIKFQEKSMKTESKTKVVTDGFSSEQATSNSAEMKR
LQAGDIDYQESKGASAMRNRLEVDGVKTEENAAVIKEALSLRTGDITQQASNNVAASSIT
VQSENFSADKKAISQSQQSQTMTSNGIISQEKHVSSASQANYSMSHKGVSSTGSSMITSS
SQMSAMNGQMLKLADLKLDDLKSLTAGSGQQEIEQTINKYSNMLTSIVSSLQEDERGGSA
ITVHDVGGKKSQYLEKINEVIRRAWAVPTHGHELGYSLCNSLRQSGGLDLLMKNCVKPDL
QFSSAQLLEQCLTTENRKHVVDNGLDKVVNVACVCTKNSNMEHSRVGTGILEHLFKHSEG
TCSDVIRLGGLDAVLFECRTSDLETLRHCASALANLSLYGGAENQEEMILRKVPMWLFPL
AFHNDDNIKYYACLAIAVLVANKEIEAEVLKSGCLDLVEPFVTSHDPSAFARSNLAHAHG
QSKHWLKRLVPVLSSNREEARNLAAFHFCMEAGIKREQGNTDIFREINAIEALKNVASCP
NAIASKFAAQALRLIGETVPHKLSQQVPLWSVEDVQEWVKQIGFNDYIDKFNESQVDGDL
LLKLNQDNLRADIGIGNGILLKRFERELQNLKRMADYSSKDTAKMHQFLSEIGTDYCTYT
YAMLNAGIDKCALPHVNEDMLMTECGIHNSIHRLRILNAVKNLENSLPSSSEENMAKTLD
VFVSYRRSNGSQLASLLKVHLQLRGFSVFIDVERLEAGKFDNGLLNSIRQAKNFVLVLTP
DALHRCINDEDCKDWVHREIVAALNSNCNIIPIIDQQFDWPEVERLPEDMRSVAHFNGVN
WIHDYQDACIDKLERFLRGEKNIDRIAAMVPGTPGSVSYQRMHSNDSDYQSGGAGAGSGA
GTGGGGGGGVTGSVVDGLMVAANGSGQANHQANRYRQSPSPARQRGSTSQLSGYSRAPSK
RSQILTPYRTQQAALLHKTGAGSASMQNMMPLAYLPPRRSSAAGLGHGSGSGMGSGYRSH
SVDGLLDQAGSTPEQRIAAAAAKVTAGSTALTNASSTSTLQPEEEVTDAALNDSVTRRDK
HTLSPPGNVQQHRKSRSLDHILSKQTLAELLPPSSELADGTQSMQNLAIPMTPQPQRRDT
SSSSKSPTPERPPQPAMERVRERQSPEGVSATESEREDQPEECLRHGNQQRASASVHRGA
SLTSNKTSNSSLGSNFSAGGNNKTIFNRTMKKVRSLIKKP
Download sequence
Identical sequences Q6IDD9
FBpp0111512 NP_001036594.1.81976 FBpp0293532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]